Property Summary

NCBI Gene PubMed Count 107
PubMed Score 64.92
PubTator Score 133.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Dermatitis, Irritant 9 0.0 0.0
Hepatitis B, Chronic 7 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 4.7e-26
Duchenne muscular dystrophy 601 4.5e-09
non-small cell lung cancer 2890 2.5e-08
malignant mesothelioma 3232 1.9e-07
Astrocytoma, Pilocytic 3081 1.9e-06
cystic fibrosis 1696 2.0e-06
lung cancer 4740 2.6e-05
juvenile dermatomyositis 1187 2.8e-05
pancreatic carcinoma 562 4.0e-05
pancreatic cancer 2398 4.0e-05
astrocytoma 1146 1.1e-04
hepatocellular carcinoma 547 3.3e-04
nephrosclerosis 333 3.5e-04
active Crohn's disease 922 6.4e-04
ependymoma 4679 8.6e-04
limb girdle muscular dystrophy 2A 213 1.4e-03
invasive ductal carcinoma 2951 1.9e-03
breast carcinoma 1638 3.2e-03
active ulcerative colitis 764 3.4e-03
medulloblastoma, large-cell 6241 3.9e-03
subependymal giant cell astrocytoma 2287 5.0e-03
interstitial cystitis 2312 5.4e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 5.8e-03
dermatomyositis 966 6.4e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 9.0e-03
Becker muscular dystrophy 191 1.3e-02
Down syndrome 499 1.3e-02
Multiple myeloma 1332 1.4e-02
adrenocortical carcinoma 1428 1.5e-02
diabetes mellitus 1728 1.8e-02
ovarian cancer 8520 1.8e-02
intraductal papillary-mucinous carcinoma (IPMC) 2989 1.9e-02
glioblastoma 5792 1.9e-02
non diabetic and post-ischemic heart failure 200 2.0e-02
Waldenstrons macroglobulinemia 765 2.2e-02
non primary Sjogren syndrome sicca 891 2.4e-02
esophageal adenocarcinoma 737 2.7e-02
head and neck cancer and chronic obstructive pulmonary disease 239 2.9e-02
adult high grade glioma 3801 3.1e-02
Pick disease 1894 3.6e-02
psoriasis 6694 3.6e-02
ductal carcinoma in situ 1745 4.6e-02
atypical teratoid / rhabdoid tumor 5112 4.8e-02

Expression

  Differential Expression (43)

Disease log2 FC p
active Crohn's disease 5.189 6.4e-04
active ulcerative colitis 4.532 3.4e-03
adrenocortical carcinoma -1.469 1.5e-02
adult high grade glioma 1.700 3.1e-02
astrocytoma 1.100 1.1e-04
Astrocytoma, Pilocytic 2.600 1.9e-06
atypical teratoid / rhabdoid tumor 1.100 4.8e-02
Becker muscular dystrophy 1.273 1.3e-02
breast carcinoma 1.100 3.2e-03
cystic fibrosis 3.064 2.0e-06
dermatomyositis 1.700 6.4e-03
diabetes mellitus -1.500 1.8e-02
Down syndrome 1.800 1.3e-02
Duchenne muscular dystrophy 2.256 4.5e-09
ductal carcinoma in situ 1.100 4.6e-02
ependymoma 1.400 8.6e-04
esophageal adenocarcinoma 1.200 2.7e-02
glioblastoma 1.300 1.9e-02
head and neck cancer and chronic obstruc... 1.500 2.9e-02
hepatocellular carcinoma -1.100 3.3e-04
interstitial cystitis 1.100 5.4e-03
intraductal papillary-mucinous adenoma (... -2.200 5.8e-03
intraductal papillary-mucinous carcinoma... -2.200 1.9e-02
invasive ductal carcinoma 1.133 1.9e-03
juvenile dermatomyositis 1.446 2.8e-05
limb girdle muscular dystrophy 2A 1.175 1.4e-03
lung cancer -2.800 2.6e-05
lung carcinoma -2.400 4.7e-26
malignant mesothelioma -3.700 1.9e-07
medulloblastoma, large-cell -1.400 3.9e-03
Multiple myeloma -1.584 1.4e-02
nephrosclerosis 1.040 3.5e-04
non diabetic and post-ischemic heart fai... 1.100 2.0e-02
non primary Sjogren syndrome sicca 1.300 2.4e-02
non-small cell lung cancer -1.064 2.5e-08
ovarian cancer -1.800 1.8e-02
pancreatic cancer -1.300 4.0e-05
pancreatic carcinoma -1.300 4.0e-05
pancreatic ductal adenocarcinoma liver m... 1.584 9.0e-03
Pick disease 1.300 3.6e-02
psoriasis 1.100 3.6e-02
subependymal giant cell astrocytoma 3.072 5.0e-03
Waldenstrons macroglobulinemia 1.631 2.2e-02

Gene RIF (108)

AA Sequence

MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKK      1 - 70
ETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHI     71 - 140
DKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWE    141 - 210
AQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL                        211 - 260
//

Text Mined References (123)

PMID Year Title