Property Summary

NCBI Gene PubMed Count 103
PubMed Score 61.99
PubTator Score 133.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 4.65193025301222E-26
non-small cell lung cancer 2798 2.16799308417445E-10
Duchenne muscular dystrophy 602 4.47858893252565E-9
pilocytic astrocytoma 3086 1.5666466490678E-8
psoriasis 6685 9.52127894531484E-8
malignant mesothelioma 3163 1.85409899908568E-7
posterior fossa group A ependymoma 1511 5.20353702688613E-7
lung cancer 4473 7.10906783531055E-7
cystic fibrosis 1670 2.02750028377622E-6
juvenile dermatomyositis 1189 2.767172602465E-5
ovarian cancer 8492 4.2302776399769E-5
limb girdle muscular dystrophy 2I 56 5.79246184018233E-5
Becker muscular dystrophy 187 2.34123858933872E-4
hepatocellular carcinoma 550 3.25430492584849E-4
nephrosclerosis 329 3.49370767480672E-4
glioblastoma 5572 4.08202898070264E-4
active Crohn's disease 918 4.09523421817389E-4
adult high grade glioma 2148 5.66735112935378E-4
primary Sjogren syndrome 789 8.00199682262554E-4
interstitial cystitis 2299 0.00242139122192977
breast carcinoma 1614 0.0031717900101641
Waldenstrons macroglobulinemia 765 0.00362485516641492
adrenocortical carcinoma 1427 0.00388015714000661
medulloblastoma, large-cell 6234 0.00394029520507642
active ulcerative colitis 477 0.00461602809333549
pancreatic cancer 2300 0.00474072371744572
pancreatic carcinoma 567 0.00474072371744577
subependymal giant cell astrocytoma 2287 0.0049767093960499
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00584817679381978
dermatomyositis 967 0.00639067906161023
astrocytoma 1493 0.00830112228883045
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00895162823448242
Down syndrome 548 0.0134477093808471
invasive ductal carcinoma 2950 0.0135435003417635
Multiple myeloma 1328 0.0143816216627436
diabetes mellitus 1663 0.0176937421272714
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0193536579417159
non diabetic and post-ischemic heart failure 200 0.0204308052646047
esophageal adenocarcinoma 737 0.0267144031264665
head and neck cancer and chronic obstructive pulmonary disease 237 0.0292329359865497
Pick disease 1893 0.0355893228562852
ductal carcinoma in situ 1745 0.0459082989804124
atypical teratoid / rhabdoid tumor 4369 0.0478337505538719
Disease Target Count Z-score Confidence
Glanzmann's thrombasthenia 21 3.436 1.7
Berylliosis 28 3.12 1.6

Expression

  Differential Expression (43)

Disease log2 FC p
nephrosclerosis 1.040 0.000
hepatocellular carcinoma -1.100 0.000
pancreatic cancer -1.400 0.005
Waldenstrons macroglobulinemia 1.745 0.004
Multiple myeloma -1.584 0.014
malignant mesothelioma -3.700 0.000
esophageal adenocarcinoma 1.200 0.027
psoriasis 1.800 0.000
astrocytoma 3.300 0.008
glioblastoma 3.600 0.000
posterior fossa group A ependymoma 2.700 0.000
cystic fibrosis 3.064 0.000
non diabetic and post-ischemic heart fai... 1.100 0.020
atypical teratoid / rhabdoid tumor 1.100 0.048
medulloblastoma, large-cell -1.400 0.004
Duchenne muscular dystrophy 2.256 0.000
limb girdle muscular dystrophy 2I 1.852 0.000
Becker muscular dystrophy 1.476 0.000
juvenile dermatomyositis 1.446 0.000
adrenocortical carcinoma -2.015 0.004
pancreatic ductal adenocarcinoma liver m... 1.584 0.009
non-small cell lung cancer -1.461 0.000
intraductal papillary-mucinous adenoma (... -2.200 0.006
intraductal papillary-mucinous carcinoma... -2.200 0.019
lung cancer -4.500 0.000
active Crohn's disease 5.512 0.000
active ulcerative colitis 4.649 0.005
breast carcinoma 1.100 0.003
diabetes mellitus -1.500 0.018
interstitial cystitis 2.300 0.002
adult high grade glioma 2.500 0.001
pilocytic astrocytoma 3.800 0.000
primary Sjogren syndrome 3.000 0.001
pancreatic carcinoma -1.400 0.005
subependymal giant cell astrocytoma 3.072 0.005
invasive ductal carcinoma 1.500 0.014
lung carcinoma -2.400 0.000
Pick disease 1.300 0.036
ductal carcinoma in situ 1.100 0.046
ovarian cancer 3.300 0.000
Down syndrome 1.800 0.013
dermatomyositis 1.700 0.006
head and neck cancer and chronic obstruc... 1.500 0.029

Synonym

Accession P20036 A9YWH7 B9UKH4 O19722 O46883 P01905 P79554 Q2Q060 Q2Q061 Q5EY03 Q5STP1 Q6DQK4 Q9BCQ1 Q9TPX3 Q9XS10
Symbols PLT1
HLADP
HLASB
DP(W3)
DP(W4)
HLA-DP1A

Gene

PDB

3LQZ   4P4K   4P4R   4P57   4P5K   4P5M  

  Ortholog (1)

Species Source
Rat OMA Inparanoid

Gene RIF (104)

PMID Text
25863099 DPA1*02:01- DPB1*14:01 and DPA1*02:01- DPB1*17:01 haplotypes provide considerable protection effect against Posner-Schlossman syndrome.
25449085 HLA-DP gene polymorphisms are strongly associated with chronic hepatitis B virus infection.
25020231 Crystal structure of the extracellular region of the HLA-DPA1/DPB1 heterodimer, in complex with the major antigenic peptide from the Japanese cedar pollen allergen.
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
24897020 The study suggests that HLA-DPA1/B1 loci are candidate susceptibility regions that have some marker single nucleotide polymorphisms for both chronic hepatitis C virus infection and F protein generation in the Han Chinese population.
24846544 rs3077 in HLA-DPA1 is a significantly associated SNP associated with chronic hepatitis B virus infection and viral clearance.
24698974 This resource provides population estimates of the frequencies of HLA alleles at these eight loci in the three population groups, particularly for HLA-DPA1 and HLA-DPB1 that were not assayed in HapMap.
24465836 Single nucleotide polymorphisms rs3077 and rs9277378 in HLA-DPA1 and HLA-DPB1 are significantly associated with protective effects against chronic hepatitis B.
24462895 Data indicate that CD4+ T cell allorecognition of HLA-DP is significantly affected by DPA1 polymorphism.
24405442 HLA-DPA1 and DPB1 allele frequencies and haplotypes of the population of Guadeloupe were most similar to African populations, with characteristic alleles and haplotypes that bespeaks the admixture with other ethnicities.
More...

AA Sequence

MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKK      1 - 70
ETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHI     71 - 140
DKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWE    141 - 210
AQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL                        211 - 260
//

Text Mined References (119)

PMID Year Title
25863099 2015 [Association of HLA-DPA1 and -DPB1 polymorphisms with Posner-Schlossman syndrome among southern Chinese Han population].
25449085 2014 [Studies on the association of single nucleotide polymorphisms of HLA-DP and DQ genes with the outcome of chronic hepatitis B virus infection].
25020231 2014 Structural basis for the specific recognition of the major antigenic peptide from the Japanese cedar pollen allergen Cry j 1 by HLA-DP5.
24897020 2014 Genetic variants in human leukocyte antigen-DP influence both hepatitis C virus persistence and hepatitis C virus F protein generation in the Chinese Han population.
24846544 2014 Association of variants in HLA-DP on chromosome 6 with chronic hepatitis B virus infection and related phenotypes.
24698974 2014 Predicting HLA alleles from high-resolution SNP data in three Southeast Asian populations.
24465836 2014 Genetic association of human leukocyte antigens with chronicity or resolution of hepatitis B infection in thai population.
24462895 2014 Allorecognition of HLA-DP by CD4+ T cells is affected by polymorphism in its alpha chain.
24405442 2014 Allele and haplotype frequencies of HLA-DPA1 and -DPB1 in the population of Guadeloupe.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...