Property Summary

NCBI Gene PubMed Count 103
Grant Count 1
Funding $50,572.67
PubMed Score 61.99
PubTator Score 133.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (43)

Disease log2 FC p
nephrosclerosis 1.040 0.000
hepatocellular carcinoma -1.100 0.000
pancreatic cancer -1.400 0.005
Waldenstrons macroglobulinemia 1.745 0.004
Multiple myeloma -1.584 0.014
malignant mesothelioma -3.700 0.000
esophageal adenocarcinoma 1.200 0.027
psoriasis 1.800 0.000
astrocytoma 3.300 0.008
glioblastoma 3.600 0.000
posterior fossa group A ependymoma 2.700 0.000
cystic fibrosis 3.064 0.000
non diabetic and post-ischemic heart fai... 1.100 0.020
atypical teratoid / rhabdoid tumor 1.100 0.048
medulloblastoma, large-cell -1.400 0.004
Duchenne muscular dystrophy 2.256 0.000
limb girdle muscular dystrophy 2I 1.852 0.000
Becker muscular dystrophy 1.476 0.000
juvenile dermatomyositis 1.446 0.000
adrenocortical carcinoma -2.015 0.004
pancreatic ductal adenocarcinoma liver m... 1.584 0.009
non-small cell lung cancer -1.461 0.000
intraductal papillary-mucinous adenoma (... -2.200 0.006
intraductal papillary-mucinous carcinoma... -2.200 0.019
lung cancer -4.500 0.000
active Crohn's disease 5.512 0.000
active ulcerative colitis 4.649 0.005
breast carcinoma 1.100 0.003
diabetes mellitus -1.500 0.018
interstitial cystitis 2.300 0.002
adult high grade glioma 2.500 0.001
pilocytic astrocytoma 3.800 0.000
primary Sjogren syndrome 3.000 0.001
pancreatic carcinoma -1.400 0.005
subependymal giant cell astrocytoma 3.072 0.005
invasive ductal carcinoma 1.500 0.014
lung carcinoma -2.400 0.000
Pick disease 1.300 0.036
ductal carcinoma in situ 1.100 0.046
ovarian cancer 3.300 0.000
Down syndrome 1.800 0.013
dermatomyositis 1.700 0.006
head and neck cancer and chronic obstruc... 1.500 0.029

Synonym

Accession P20036 A9YWH7 B9UKH4 O19722 O46883 P01905 P79554 Q2Q060 Q2Q061 Q5EY03 Q5STP1 Q6DQK4 Q9BCQ1 Q9TPX3 Q9XS10
Symbols PLT1
HLADP
HLASB
DP(W3)
DP(W4)
HLA-DP1A

Gene

 Grant Application (1)

PDB

3LQZ   4P4K   4P4R   4P57   4P5K   4P5M  

Gene RIF (108)

PMID Text
25863099 DPA1*02:01- DPB1*14:01 and DPA1*02:01- DPB1*17:01 haplotypes provide considerable protection effect against Posner-Schlossman syndrome.
25449085 HLA-DP gene polymorphisms are strongly associated with chronic hepatitis B virus infection.
25020231 Crystal structure of the extracellular region of the HLA-DPA1/DPB1 heterodimer, in complex with the major antigenic peptide from the Japanese cedar pollen allergen.
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
24897020 The study suggests that HLA-DPA1/B1 loci are candidate susceptibility regions that have some marker single nucleotide polymorphisms for both chronic hepatitis C virus infection and F protein generation in the Han Chinese population.
24846544 rs3077 in HLA-DPA1 is a significantly associated SNP associated with chronic hepatitis B virus infection and viral clearance.
24698974 This resource provides population estimates of the frequencies of HLA alleles at these eight loci in the three population groups, particularly for HLA-DPA1 and HLA-DPB1 that were not assayed in HapMap.
24465836 Single nucleotide polymorphisms rs3077 and rs9277378 in HLA-DPA1 and HLA-DPB1 are significantly associated with protective effects against chronic hepatitis B.
24462895 Data indicate that CD4+ T cell allorecognition of HLA-DP is significantly affected by DPA1 polymorphism.
24405442 HLA-DPA1 and DPB1 allele frequencies and haplotypes of the population of Guadeloupe were most similar to African populations, with characteristic alleles and haplotypes that bespeaks the admixture with other ethnicities.
More...

AA Sequence

MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKK      1 - 70
ETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHI     71 - 140
DKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWE    141 - 210
AQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL                        211 - 260
//

Text Mined References (119)

PMID Year Title
25863099 2015 [Association of HLA-DPA1 and -DPB1 polymorphisms with Posner-Schlossman syndrome among southern Chinese Han population].
25449085 2014 [Studies on the association of single nucleotide polymorphisms of HLA-DP and DQ genes with the outcome of chronic hepatitis B virus infection].
25020231 2014 Structural basis for the specific recognition of the major antigenic peptide from the Japanese cedar pollen allergen Cry j 1 by HLA-DP5.
24897020 2014 Genetic variants in human leukocyte antigen-DP influence both hepatitis C virus persistence and hepatitis C virus F protein generation in the Chinese Han population.
24846544 2014 Association of variants in HLA-DP on chromosome 6 with chronic hepatitis B virus infection and related phenotypes.
24698974 2014 Predicting HLA alleles from high-resolution SNP data in three Southeast Asian populations.
24465836 2014 Genetic association of human leukocyte antigens with chronicity or resolution of hepatitis B infection in thai population.
24462895 2014 Allorecognition of HLA-DP by CD4+ T cells is affected by polymorphism in its alpha chain.
24405442 2014 Allele and haplotype frequencies of HLA-DPA1 and -DPB1 in the population of Guadeloupe.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...