Property Summary

NCBI Gene PubMed Count 115
Grant Count 303
R01 Count 195
Funding $51,096,175.08
PubMed Score 917.27
PubTator Score 1018.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.965 0.000
osteosarcoma -1.418 0.000
interstitial cystitis 4.100 0.001
lung adenocarcinoma 1.600 0.000
primary Sjogren syndrome 3.500 0.000
nasopharyngeal carcinoma -1.900 0.003
non-small cell lung carcinoma 1.100 0.000
ulcerative colitis 2.700 0.016

Synonym

Accession P20023 C9JHD2 Q13866 Q14212 Q53EL2 Q5BKT9 Q5SR46 Q5SR48 Cr2
Symbols CR
C3DR
CD21
CVID7
SLEB9

Gene

CR2

PDB

1GHQ   1W2S   3OED   1LY2   1W2R   2GSX  

Gene RIF (86)

PMID Text
26452134 Reduced expression of CD21 on CLL B-cells appears functionally relevant and was associated with poor clinical outcomes.
26189291 THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES
25817480 repression of the CR2/CD21 promoter can occur through one of the E-box motifs via recruitment of RP58.
25640655 In mature B cells, CD21 transcription proceeds from a focused transcriptional start site regulated by a non-consensus TATA box, an initiator element and a downstream promoter element.
25569262 found that the protective CR2 genotype is correlated with lower levels CR2 mRNA as well as differences in the ratio of the long and short CR2 isoforms
25385064 The paradoxical enhancement of immune responses by C3d in the absence of CD21 is due to internalization and processing of C3d into peptides that activate autoreactive CD4(+) T-helper cells.
25180293 These data suggest that rs1876453 in CR2 has long-range effects on gene regulation that decrease susceptibility to systemic lupus erythematosus.
24675670 Higher C3d/C3 ratios were found for current smoker, higher age, age-related macular degeneration phenotype, and the two SNPs in the C3 gene, rs6795735 and rs2230199.
24600013 Authors show that expression of the Epstein-Barr virus B-cell attachment receptor, CD21, in B cells that lack this receptor results in significant changes in gene expression, both before and rapidly following EBV-CD21 interaction.
23612877 Our findings implicate CR2 as a susceptibility gene for nasopharyngeal carcinoma and suggest that enhanced CR2 expression may be involved in the oncogenesis and development of nasopharyngeal carcinoma.
More...

AA Sequence

MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDK      1 - 70
VDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGP     71 - 140
TRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTC    141 - 210
EEARCKSLGRFPNGKVKEPPILRVGVTANFFCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPP    211 - 280
PILNGRHIGNSLANVSYGSIVTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQ    281 - 350
CPHPQILRGRMVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQ    351 - 420
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLTKPQHQFVRPD    421 - 490
VNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGP    491 - 560
ERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAVQCSHVHIANGYKISGKEAPYFYNDTVTFKC    561 - 630
YSGFTLKGSSQIRCKADNTWDPEIPVCEKETCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQ    631 - 700
DAENGIWFKKIPLCKVIHCHPPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHG    701 - 770
SWSGPSPQCLRSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGV    771 - 840
PTCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTWSQPAPHCKEV    841 - 910
NCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQWNPPLAVCRSRSLAPVLCGI    911 - 980
AAGLILLTFLIVITLYVISKHRARNYYTDTSQKEAFHLEAREVYSVDPYNPAS                     981 - 1033
//

Text Mined References (122)

PMID Year Title
26452134 2015 A CD21 low phenotype, with no evidence of autoantibodies to complement proteins, is consistent with a poor prognosis in CLL.
26189291 2015 [THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES].
25817480 2015 Analysis of tandem E-box motifs within human Complement receptor 2 (CR2/CD21) promoter reveals cell specific roles for RP58, E2A, USF and localized chromatin accessibility.
25640655 2016 Focused transcription from the human CR2/CD21 core promoter is regulated by synergistic activity of TATA and Initiator elements in mature B cells.
25569262 2015 Association of complement receptor 2 polymorphisms with innate resistance to HIV-1 infection.
25385064 2015 C3d adjuvant effects are mediated through the activation of C3d-specific autoreactive T cells.
25180293 2016 Preferential association of a functional variant in complement receptor 2 with antibodies to double-stranded DNA.
24675670 2014 Impact of the common genetic associations of age-related macular degeneration upon systemic complement component C3d levels.
24600013 2014 Analysis of host gene expression changes reveals distinct roles for the cytoplasmic domain of the Epstein-Barr virus receptor/CD21 in B-cell maturation, activation, and initiation of virus infection.
23612877 2013 Functional polymorphism in the 5'-UTR of CR2 is associated with susceptibility to nasopharyngeal carcinoma.
More...