Property Summary

NCBI Gene PubMed Count 122
PubMed Score 940.30
PubTator Score 1018.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.7
Skin cancer 469 0.0 0.7
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.9
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 4.0

Expression

  Differential Expression (8)

Disease log2 FC p
interstitial cystitis 4.100 7.1e-04
lung adenocarcinoma 1.600 8.1e-08
nasopharyngeal carcinoma -1.900 3.2e-03
non-small cell lung carcinoma 1.100 2.3e-12
osteosarcoma -1.418 4.2e-04
primary Sjogren syndrome 3.500 2.4e-05
ulcerative colitis 2.700 1.6e-02
Waldenstrons macroglobulinemia -1.965 1.7e-04

 GWAS Trait (1)

Gene RIF (94)

AA Sequence

MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDK      1 - 70
VDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGP     71 - 140
TRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTC    141 - 210
EEARCKSLGRFPNGKVKEPPILRVGVTANFFCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPP    211 - 280
PILNGRHIGNSLANVSYGSIVTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQ    281 - 350
CPHPQILRGRMVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQ    351 - 420
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLTKPQHQFVRPD    421 - 490
VNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGP    491 - 560
ERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAVQCSHVHIANGYKISGKEAPYFYNDTVTFKC    561 - 630
YSGFTLKGSSQIRCKADNTWDPEIPVCEKETCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQ    631 - 700
DAENGIWFKKIPLCKVIHCHPPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHG    701 - 770
SWSGPSPQCLRSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGV    771 - 840
PTCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTWSQPAPHCKEV    841 - 910
NCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQWNPPLAVCRSRSLAPVLCGI    911 - 980
AAGLILLTFLIVITLYVISKHRARNYYTDTSQKEAFHLEAREVYSVDPYNPAS                     981 - 1033
//

Text Mined References (129)

PMID Year Title