Property Summary

NCBI Gene PubMed Count 77
PubMed Score 100.01
PubTator Score 67.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 1.112 7.4e-04
adult high grade glioma -1.400 2.6e-03
astrocytic glioma -2.000 2.0e-03
Astrocytoma, Pilocytic -1.500 3.2e-03
atypical teratoid / rhabdoid tumor -2.500 3.4e-05
Barrett's esophagus 1.100 3.6e-02
Breast cancer -1.100 5.8e-06
cystic fibrosis 1.136 1.2e-04
ependymoma -1.600 5.0e-02
Gaucher disease type 1 -1.500 4.1e-02
glioblastoma -1.300 1.7e-05
medulloblastoma -1.100 2.7e-04
medulloblastoma, large-cell -1.600 2.4e-03
oligodendroglioma -1.500 4.8e-02
osteosarcoma 3.233 7.1e-07
ovarian cancer -1.900 2.2e-05
Parkinson's disease -1.500 4.1e-02
pituitary cancer 1.200 5.1e-04
primary Sjogren syndrome 1.200 1.3e-03
primitive neuroectodermal tumor -1.700 3.4e-03
psoriasis 1.100 3.5e-02
Rheumatoid arthritis 1.500 4.7e-02
tuberculosis -1.700 1.4e-03
ulcerative colitis -1.140 4.5e-03

Gene RIF (45)

AA Sequence

MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEG      1 - 70
LSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEV     71 - 140
SVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRGGQVIQIPVADI    141 - 210
TVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGV    211 - 280
NSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKK    281 - 350
KANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF    351 - 420
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA    421 - 490
YINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRHVGNKTECALLGLLLDLKRDY    491 - 560
QDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD    561 - 630
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRA    631 - 700
GITVRMVTGDNINTARAIATKCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSP    701 - 770
TDKHTLVKGIIDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK    771 - 840
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTES    841 - 910
LLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGRNAPLHAPPSEHYTIVFNTFV    911 - 980
LMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQIIIVQFGGKPFSCSELSIEQWLWSIFLGMG    981 - 1050
TLLWGQLISTIPTSRLKFLKEAGHGTQKEEIPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDV   1051 - 1120
VNAFQSGSSIQGALRRQPSIASQHHDVTNISTPTHIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFRI   1121 - 1190
EDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEMNKSATSSSPGSPLHSLETSL     1191 - 1258
//

Text Mined References (83)

PMID Year Title