Property Summary

NCBI Gene PubMed Count 74
Grant Count 8
R01 Count 6
Funding $494,661.61
PubMed Score 88.25
PubTator Score 67.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.047
astrocytic glioma -3.000 0.001
ependymoma -3.100 0.005
oligodendroglioma -2.600 0.019
Barrett's esophagus 1.100 0.036
psoriasis -2.000 0.000
glioblastoma -2.500 0.001
osteosarcoma 3.233 0.000
cystic fibrosis 1.615 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.600 0.002
primitive neuroectodermal tumor -2.400 0.000
ulcerative colitis -1.300 0.000
adrenocortical carcinoma 1.326 0.000
tuberculosis -1.800 0.001
Parkinson's disease -1.500 0.041
adult high grade glioma -2.100 0.004
pilocytic astrocytoma -1.500 0.004
primary Sjogren syndrome 1.200 0.001
Breast cancer -1.100 0.000
ovarian cancer -2.100 0.000
Gaucher disease type 1 -1.500 0.041
pituitary cancer 2.200 0.000

Gene RIF (43)

PMID Text
26307527 Data show that plasma membrane Ca(2+)-ATPase (PMCA) was associated with tubulin in normotensive and hypertensive erythrocytes.
26116539 While PMCA1b has a housekeeping function in colon cancer cells, PMCA4b participates in the reorganization of the calcium signaling machinery during cell differentiation.
25618516 rs11105378 near ATP2B1 was associated with increased systolic and diastolic blood pressure in a Chinese population.
25605721 An increase of phosphatidylcholine/detergent molar ratio leads to a biphasic behavior of the PMCA Ca2+-ATPase activity, whose maximum depends on phosphatidylcholine characteristics.
25385345 ATP2B1 rs12817819 A allele is associated with increased risk for drug resistant hypertension.
24642721 Report that ATP2B1 rs2681472 is associated with early-onset preeclampsia in Northern Han Chinese women.
24584935 analysis of how human plasma membrane Ca2+ pump PMCA h4xb is hyperactivated by mutation of Glu99 to Lys
23817774 The downregulation of PMCA1 and the disruption of calcium homeostasis may play important roles in UVB-induced HLE B-3 cell apoptosis.
23759979 The present study confirmed the significant association of ATP2B1 rs17249754 with risk of hypertension among Chinese children.
23079715 Association of the ATP2B1 gene and susceptibility to hypertension, blood pressure traits and carotid-femoral pulse wave velocities in a Chinese population.
More...

AA Sequence

MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEG      1 - 70
LSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEV     71 - 140
SVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRGGQVIQIPVADI    141 - 210
TVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGV    211 - 280
NSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKK    281 - 350
KANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF    351 - 420
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA    421 - 490
YINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRHVGNKTECALLGLLLDLKRDY    491 - 560
QDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRD    561 - 630
DIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRA    631 - 700
GITVRMVTGDNINTARAIATKCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSP    701 - 770
TDKHTLVKGIIDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK    771 - 840
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTES    841 - 910
LLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGRNAPLHAPPSEHYTIVFNTFV    911 - 980
LMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQIIIVQFGGKPFSCSELSIEQWLWSIFLGMG    981 - 1050
TLLWGQLISTIPTSRLKFLKEAGHGTQKEEIPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDV   1051 - 1120
VNAFQSGSSIQGALRRQPSIASQHHDVTNISTPTHIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFRI   1121 - 1190
EDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEMNKSATSSSPGSPLHSLETSL     1191 - 1258
//

Text Mined References (80)

PMID Year Title
26307527 2015 PMCA activity and membrane tubulin affect deformability of erythrocytes from normal and hypertensive human subjects.
26116539 2015 Selective upregulation of the expression of plasma membrane calcium ATPase isoforms upon differentiation and 1,25(OH)2D3-vitamin treatment of colon cancer cells.
25618516 2015 Variant Near FGF5 Has Stronger Effects on Blood Pressure in Chinese With a Higher Body Mass Index.
25605721 2015 Modulation of plasma membrane Ca2+-ATPase by neutral phospholipids: effect of the micelle-vesicle transition and the bilayer thickness.
25385345 2014 Large-scale gene-centric analysis identifies polymorphisms for resistant hypertension.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24642721 2014 The common single-nucleotide polymorphism rs2681472 is associated with early-onset preeclampsia in Northern Han Chinese women.
24584935 2014 Hyperactivation of the human plasma membrane Ca2+ pump PMCA h4xb by mutation of Glu99 to Lys.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...