Property Summary

Ligand Count 27
NCBI Gene PubMed Count 156
PubMed Score 677.77
PubTator Score 516.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Malignant tumor of colon 19
Disease Target Count
Stomach cancer 30

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis 2.300 1.2e-04
cutaneous lupus erythematosus 2.300 1.0e-03
ependymoma 1.100 3.2e-02
interstitial cystitis 1.400 5.3e-04
juvenile dermatomyositis 1.261 3.1e-09
lung cancer -2.300 3.3e-05
medulloblastoma, large-cell -1.100 1.3e-03
pancreatic cancer 1.200 3.9e-04
psoriasis 2.100 7.7e-07
ulcerative colitis 1.004 3.0e-02

 GO Component (1)

Gene RIF (123)

AA Sequence

MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQ      1 - 70
IGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKV     71 - 140
PMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDS    141 - 210
LPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRC    211 - 280
VGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQ    281 - 350
GVDPGLARALCSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG    351 - 420
AELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSDRAPFAAPSPFAELVLPPQQ            421 - 482
//

Text Mined References (160)

PMID Year Title