Property Summary

NCBI Gene PubMed Count 150
Grant Count 113
R01 Count 55
Funding $23,187,632.35
PubMed Score 666.71
PubTator Score 516.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.100 0.032
psoriasis 3.500 0.000
cutaneous lupus erythematosus 2.300 0.001
medulloblastoma, large-cell -1.100 0.001
ulcerative colitis 1.004 0.030
juvenile dermatomyositis 1.261 0.000
Atopic dermatitis 2.300 0.000
lung cancer -2.300 0.000
pancreatic cancer 1.200 0.000
interstitial cystitis 1.400 0.001

Synonym

Accession P19971 A8MW15 H9KVA0 Q13390 Q8WVB7 TP
Symbols TP
ECGF
ECGF1
MNGIE
MEDPS1
MTDPS1
PDECGF
hPD-ECGF

Gene

PANTHER Protein Class (2)

PDB

1UOU   2J0F   2WK5   2WK6  

 GO Component (1)

Gene RIF (117)

PMID Text
26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
26676225 High VEGF expression was subsequently correlated with a short overall survival rate for patients exhibiting lymph node metastasis (P=0.0128); however, there was no significant difference in overall survival rate regarding the expression levels of TP and CD34
26617778 Pretreatment expression of thymidine phosphorylase/HIF-1alpha were found to predict pathologic response and outcomes in clinical stage II/III rectal cancer receiving neoadjuvant chemoradiotherapy.
25304388 4-methylumbelliferone exerts its antitumor effect on ovarian cancer through suppressing thymidine phosphorylase expression.
25027354 Gastrointestinal cancer patient carriers of the thymidine phosphorylase rs11479 T allele, with a low platelet count, could be at risk of a poor outcome.
24819505 action of thymidine phosphorylase in non-small cell lung cancer: crosstalk with Nrf2 and HO-1
24798152 thymidine phosphorylase could strongly influence gastric cancer progression via the dual activities of angiogenesis and lymphangiogenesis
24617035 thymidine phosphorylase is more likely expressed by malignant B cells in higher-grade lymphomas
24455740 We suggest that a chip including DPYD, TYMS, TYMP, TK1, and TK2 genes is a potential tool to predict response in LARC following fluoropyrimidine-based CCRT
24448160 These results demonstrate that the use of AAV to direct TYMP expression in liver is feasible as a potentially safe gene therapy strategy for Mitochondrial neurogastrointestinal encephalomyopathy.
More...

AA Sequence

MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQ      1 - 70
IGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKV     71 - 140
PMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDS    141 - 210
LPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRC    211 - 280
VGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQ    281 - 350
GVDPGLARALCSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG    351 - 420
AELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSDRAPFAAPSPFAELVLPPQQ            421 - 482
//

Text Mined References (154)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
26676225 2016 Clinicopathological significance of vascular endothelial growth factor, thymidine phosphorylase and microvessel density in colorectal cancer.
26617778 2015 Thymidine phosphorylase and hypoxia-inducible factor 1-? expression in clinical stage II/III rectal cancer: association with response to neoadjuvant chemoradiation therapy and prognosis.
25304388 2014 4-Methylumbelliferone inhibits ovarian cancer growth by suppressing thymidine phosphorylase expression.
25027354 2014 Thymidine phosphorylase gene variant, platelet counts and survival in gastrointestinal cancer patients treated by fluoropyrimidines.
24819505 2014 Regulation and novel action of thymidine phosphorylase in non-small cell lung cancer: crosstalk with Nrf2 and HO-1.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24798152 2014 Angiogenic factor thymidine phosphorylase associates with angiogenesis and lymphangiogenesis in the intestinal-type gastric cancer.
24617035 2013 Thymidine phosphorylase expression in B-cell lymphomas and its significance: a new prognostic marker?
More...