Property Summary

NCBI Gene PubMed Count 25
Grant Count 2
Funding $338,866
PubMed Score 111.46
PubTator Score 26.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Chromosome 1p36 deletion syndrome 24 3.281 1.6

Expression

Synonym

Accession P19961 B3KTI1 B3KXB7 D3DT76 Q9UBH3
Symbols HXA
AMY2
AMY3

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (1)

PMID Text
16152770 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF      1 - 70
RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRD     71 - 140
FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFR    141 - 210
LDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV    211 - 280
IRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF    281 - 350
TRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP    351 - 420
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA    421 - 490
HFSISNSAEDPFIAIHAESKL                                                     491 - 511
//

Text Mined References (26)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16152770 2005 On the genetic polymorphism of the serum alpha-amylase in the population of the south western Bulgaria (second communication).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15286789 2004 Detection of large-scale variation in the human genome.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11408008 2001 alpha-Amylase expressed in human liver is encoded by the AMY-2B gene identified in tumorous tissues.
More...