Property Summary

NCBI Gene PubMed Count 86
PubMed Score 991.16
PubTator Score 253.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Dermatitis, Contact 71 0.0 0.0
Disease Target Count
Contact Dermatitis 81
Disease Target Count P-value
psoriasis 6694 0.0e+00

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 9.000 0.0e+00

Gene RIF (61)

AA Sequence

MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS      1 - 70
TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ                            71 - 117
//

Text Mined References (86)

PMID Year Title