Property Summary

NCBI Gene PubMed Count 109
PubMed Score 1179.45
PubTator Score 189.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 2.050 1.4e-07
adult high grade glioma 1.300 2.5e-03
Amyotrophic lateral sclerosis 1.142 1.4e-06
Astrocytoma, Pilocytic 1.500 1.6e-04
Atopic dermatitis -1.100 4.4e-03
atypical teratoid / rhabdoid tumor 2.600 6.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.822 3.6e-04
Breast cancer -1.400 1.5e-03
cystic fibrosis -1.210 1.9e-03
Duchenne muscular dystrophy 1.351 1.4e-04
glioblastoma 1.100 1.9e-03
intraductal papillary-mucinous adenoma (... -1.900 3.8e-03
juvenile dermatomyositis 1.249 4.3e-09
lung cancer 3.900 1.7e-05
medulloblastoma, large-cell 1.100 1.1e-02
non-small cell lung cancer 1.976 1.9e-07
osteosarcoma 1.222 3.0e-03
ovarian cancer 1.500 1.5e-03
pituitary cancer -1.200 3.5e-03
primitive neuroectodermal tumor 1.800 1.5e-03
psoriasis -1.100 1.0e-08
sonic hedgehog group medulloblastoma 1.100 3.1e-02
ulcerative colitis 1.500 1.4e-02

 GO Component (1)

 GWAS Trait (1)

Gene RIF (87)

AA Sequence

MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDV      1 - 70
NDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYR     71 - 140
NECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGND    141 - 210
GVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSD    211 - 280
EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW          281 - 344
//

Text Mined References (113)

PMID Year Title