Property Summary

NCBI Gene PubMed Count 99
Grant Count 291
R01 Count 186
Funding $29,203,996.71
PubMed Score 1100.78
PubTator Score 189.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19883 B5BU94 Q9BTH0 FS
Symbols FS

Gene

FST

PANTHER Protein Class (1)

PDB

2B0U   2P6A   3HH2  

Gene RIF (77)

PMID Text
26844494 serum concentrations positively associated with serum free thyroxine levels in hyperthyroid or euthyroid patients
26652766 Circulating follistatin may be a marker of the glucagon-to-insulin tone on the liver
26415587 Study shows that INHBA and FST are induced by seminal fluid in cervical tissues and thus, may contribute to regulation of the post-coital response in women.
26086422 Adenomyotic tissues express high levels of myostatin, follistatin, and activin type II receptors.
25885021 Two angiogenic factors, follistatin (and HGF) are associated with prognosis in esophageal cancer patients.
25565002 changes in Follistatin levels during pregnancy contribute to the control of the activin A system
25361680 We report here an original observation that activin-B is upregulated in the human idiopathic pulmonary fibrosis lung.
24885241 higher than normal serum values common in H1N1 infection but found no association with the severity of respiratory failure
24763182 Circulating follistatin levels are reduced in gestational diabetes mellitus and are positively associated with fetal growth and neonatal adiposity.
24667650 ERRbeta signalling leads to BCAS2-mediated blockage of the G1/S transition and inhibition of the epithelial to mesenchymal transition through FST-mediated regulation of E-cadherin
More...

AA Sequence

MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDV      1 - 70
NDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYR     71 - 140
NECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGND    141 - 210
GVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSD    211 - 280
EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW          281 - 344
//

Text Mined References (102)

PMID Year Title
26844494 2016 Serum Levels of Follistatin Are Positively Associated With Serum-Free Thyroxine Levels in Patients With Hyperthyroidism or Euthyroidism.
26652766 2016 Circulating Follistatin Is Liver-Derived and Regulated by the Glucagon-to-Insulin Ratio.
26415587 2015 Seminal fluid factors regulate activin A and follistatin synthesis in female cervical epithelial cells.
26086422 2015 Myostatin, follistatin and activin type II receptors are highly expressed in adenomyosis.
25885021 2015 Association of angiogenic factors with prognosis in esophageal cancer.
25565002 2015 Longitudinal analysis of maternal serum Follistatin concentration in normal pregnancy and preeclampsia.
25361680 2014 Upregulation of activin-B and follistatin in pulmonary fibrosis - a translational study using human biopsies and a specific inhibitor in mouse fibrosis models.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24885241 2014 Serum activin A and B, and follistatin in critically ill patients with influenza A(H1N1) infection.
24763182 2014 Serum activin A and follistatin levels in gestational diabetes and the association of the Activin A-Follistatin system with anthropometric parameters in offspring.
More...