Property Summary

NCBI Gene PubMed Count 120
PubMed Score 199.80
PubTator Score 154.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 5.0
Disease Target Count Z-score Confidence
Microsporidiosis 13 3.506 1.8
Retinitis pigmentosa 47 4 3.468 1.7

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.100 1.9e-02
cystic fibrosis 1.122 1.7e-05
diabetes mellitus -1.400 2.3e-02
glioblastoma 1.300 8.2e-04
inflammatory breast cancer 1.300 3.7e-03
interstitial cystitis 2.000 9.0e-04
intraductal papillary-mucinous adenoma (... -1.600 6.1e-04
intraductal papillary-mucinous carcinoma... -1.500 1.7e-03
invasive ductal carcinoma 1.807 3.2e-04
lung adenocarcinoma -1.600 6.7e-07
lung cancer -4.200 4.3e-05
lung carcinoma -3.700 2.1e-30
mucosa-associated lymphoid tissue lympho... 2.479 6.1e-03
non-small cell lung cancer -1.975 6.4e-18
osteosarcoma -2.518 8.1e-03
ovarian cancer -1.800 1.3e-05
pancreatic cancer 1.200 6.8e-03
posterior fossa group A ependymoma 1.100 1.1e-04
ulcerative colitis 3.000 3.6e-06

Protein-protein Interaction (8)

Gene RIF (74)

AA Sequence

MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHL      1 - 70
AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKA     71 - 140
EEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLAKKDYLGKATVVASVVD    141 - 210
QDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATV    211 - 280
MFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPM    281 - 350
PYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNY    351 - 420
CLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKV    421 - 490
NEEWLEGECKGKVGIFPKVFVEDCATTDLESTRREV                                      491 - 526
//

Text Mined References (127)

PMID Year Title