Property Summary

NCBI Gene PubMed Count 114
Grant Count 124
R01 Count 97
Funding $9,001,114.76
PubMed Score 195.38
PubTator Score 154.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19878 B2R6Q1 B4DKQ7 B4DQA7 E9PHJ2 E9PHX3 Q2PP06 Q8NFC7 Q9BV51 NCF-2
Symbols NCF-2
NOXA2
P67PHOX
P67-PHOX

Gene

PANTHER Protein Class (2)

PDB

1E96   1K4U   1OEY   1HH8   1WM5   2DMO  

Gene RIF (69)

PMID Text
26272171 A novel homozygous mutation in NCF2.
26160850 results reveal an essential role for the Cys-Gly-Cys triad in Nox2 in binding p67(phox), seconded by an additional binding region, comprising residues C terminal to Cys-Gly-Cys. The 2 regions interact with distinct partner sites in p67(phox).
25795782 This model assigns a central role to Arg-395 in the structure and stability of the quaternary NCF2/NCF4/VAV1/RAC1 NADPH oxidase complex.
25056956 Data indicate that arachidonic acid induces the direct interaction of Rac-GTP-bound p67(phox) with the C-terminal cytosolic region of phagocyte NADPH oxidase Nox2.
24596025 Four novel mutations in the NCF1, NCF2, and CYBB genees have been identified in chronic granulomatous disease patients in Morocco.
24163247 Results not only establish allelic heterogeneity within NCF2 associated with SLE, but also emphasize the utility of multi-ethnic cohorts to identify predisposing variants explaining additional phenotypic variance of complex diseases like SLE.
24162774 HIV-1 gp120 downregulates the expression of neutrophil cytosolic factor 2 (NCF2) in human B cells
23821607 NCF2 in Asian populations shows a pattern of diversity characterized by a differentiated haplotype structure.
23264412 Case Report: report defects in NCF-2, teh gene encoding p67-phox, in four cases of chronic granulomatous disease.
23187810 Results provide insight into the redox-sensitive signaling mechanism that mediates cell survival involving p53 and its novel target NCF2/p67phox.
More...

AA Sequence

MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHL      1 - 70
AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKA     71 - 140
EEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLAKKDYLGKATVVASVVD    141 - 210
QDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATV    211 - 280
MFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPM    281 - 350
PYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNY    351 - 420
CLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKV    421 - 490
NEEWLEGECKGKVGIFPKVFVEDCATTDLESTRREV                                      491 - 526
//

Text Mined References (120)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26272171 2015 A novel mutation in NCF2 associated with autoimmune disease and a solitary late-onset infection.
26160850 2015 A Cys-Gly-Cys triad in the dehydrogenase region of Nox2 plays a key role in the interaction with p67phox.
25795782 2015 Systemic lupus erythematosus-associated neutrophil cytosolic factor 2 mutation affects the structure of NADPH oxidase complex.
25416956 2014 A proteome-scale map of the human interactome network.
25056956 2014 Arachidonic acid induces direct interaction of the p67(phox)-Rac complex with the phagocyte oxidase Nox2, leading to superoxide production.
24596025 2014 Chronic granulomatous disease in Morocco: genetic, immunological, and clinical features of 12 patients from 10 kindreds.
24163247 2014 Allelic heterogeneity in NCF2 associated with systemic lupus erythematosus (SLE) susceptibility across four ethnic populations.
23910690 2013 Clinical, functional, and genetic characterization of chronic granulomatous disease in 89 Turkish patients.
23821607 2013 Evolutionary dynamics of the human NADPH oxidase genes CYBB, CYBA, NCF2, and NCF4: functional implications.
More...