Property Summary

NCBI Gene PubMed Count 39
PubMed Score 74.67
PubTator Score 41.52

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 8.20510295192379E-45
non-small cell lung cancer 2798 2.56644853303201E-16
ulcerative colitis 2087 1.25057247700141E-11
posterior fossa group A ependymoma 1511 1.0256671635051E-8
malignant mesothelioma 3163 1.12237528406544E-7
lung cancer 4473 3.87048973868384E-7
tuberculosis 1563 6.73485679718195E-6
lung adenocarcinoma 2714 4.42308029662571E-5
head and neck cancer 270 1.53986538916846E-4
pancreatic cancer 2300 1.63327496467302E-4
cystic fibrosis 1670 6.91300736481838E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00461460551872019
nasopharyngeal carcinoma 1056 0.0103226518706024
active Crohn's disease 918 0.0152147062560324
ovarian cancer 8492 0.0165106132883175
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0183728155624381
esophageal adenocarcinoma 737 0.0254498837300123
spina bifida 1064 0.026905982052635
interstitial cystitis 2299 0.0289578040533906
gastric carcinoma 832 0.0306130240347339
Barrett's esophagus 185 0.0346543987280131
colon cancer 1475 0.0352930050980546
Disease Target Count Z-score Confidence
Influenza 142 3.549 1.8


  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -3.900 0.000
Barrett's esophagus 1.700 0.035
esophageal adenocarcinoma 2.000 0.025
posterior fossa group A ependymoma 3.500 0.000
cystic fibrosis 3.300 0.001
tuberculosis -5.100 0.000
non-small cell lung cancer -2.788 0.000
intraductal papillary-mucinous adenoma (... 1.800 0.005
intraductal papillary-mucinous neoplasm ... 1.900 0.018
colon cancer 2.000 0.035
lung cancer -5.500 0.000
active Crohn's disease 3.572 0.015
ulcerative colitis 5.100 0.000
pancreatic cancer 2.100 0.000
interstitial cystitis 1.500 0.029
nasopharyngeal carcinoma 1.300 0.010
lung adenocarcinoma -1.465 0.000
spina bifida -1.544 0.027
gastric carcinoma 2.700 0.031
ovarian cancer 1.200 0.017
head and neck cancer 1.900 0.000
psoriasis 2.100 0.000


Accession P19876 Q4W5H9
Symbols GRO3


  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Cow OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (20)

24605943 results support a functional role of CXCL3 in breast cancer metastasis and as a viable target for cancer therapy
23904157 our results demonstrate the diverse mechanisms by which CXCL2 and CXCL3 mediate normal and asthmatic airway smooth muscle cell migration
23589610 secreted growth-regulated oncogene chemokines, specifically GRO-gamma, in human Mesenchymal stromal cell-conditioned media have an effect on the differentiation and the function of human monocyte-derived dendritic cells.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of chemokine (C-X-C motif) ligand 3 (CXCL3) in peptide-treated PBMCs
23225384 This study demonistrated that CXCL1, CXCL2, CXCL3, CXCL8, and CXCL11, absent from normal muscle fibers, were induced in DMD myofibers.
23023221 Data show that mesenchymal stem cells (MSCs) directly regulate T cell proliferation by induction of CXCL3 chemokine and its receptor, CXCR2 on the surface in T cells.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20162422 A significantly increased expression of GRO-2, GRO-3, and IL-8 in colon carcinoma as compared to normal tissue, is reported.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19741597 overexpression of CXCL13 in the intestine during inflammatory conditions favors mobilization of B cells and of LTi and NK cells with immunomodulatory and reparative functions.
19448742 propose that chemokines belonging to the CXC family could play an important role in the etiology of tendon xanthoma (TX), with CXCL3 being a possible biological marker of onset and development of TX
19369450 Report gonadotropin-releasing hormone-regulated CXCL3 expression in human placentation.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17466952 Inhibition of ERK phosphorylation decreased expression of GRO3.
17389786 GRO-gamma is a promising candidate for Th2-associated glomerular permeability factor in minimal change disease.
16356540 demonstrates, for the first time, that BIRC3 (anti-apoptotic protein), COL3A1 (matrix protein synthesis), and CXCL3 (chemokine) were up-regulated in the thrombin-stimulated human umbilical vein endothelial cells
12949249 CXCL3 displays antimicrobial activity against E. coli and S. aureus.

AA Sequence

QTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN                                      71 - 107

Text Mined References (40)

PMID Year Title
24605943 2014 CXCL3 is a potential target for breast cancer metastasis.
23904157 2013 Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration.
23589610 2013 Mesenchymal stem cells tune the development of monocyte-derived dendritic cells toward a myeloid-derived suppressive phenotype through growth-regulated oncogene chemokines.
23225384 2012 Upregulation of chemokines and their receptors in Duchenne muscular dystrophy: potential for attenuation of myofiber necrosis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23023221 2012 Mesenchymal stem cells regulate the proliferation of T cells via the growth-related oncogene/CXC chemokine receptor, CXCR2.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20162422 2010 Differential expression of the chemokines GRO-2, GRO-3, and interleukin-8 in colon cancer and their impact on metastatic disease and survival.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19741597 2009 CXCL13 expression in the gut promotes accumulation of IL-22-producing lymphoid tissue-inducer cells, and formation of isolated lymphoid follicles.
19448742 2009 Overexpression of the CXCL3 gene in response to oxidized low-density lipoprotein is associated with the presence of tendon xanthomas in familial hypercholesterolemia.
19369450 2009 Gonadotropin-releasing hormone-regulated chemokine expression in human placentation.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17466952 2007 Role of IKK and ERK pathways in intrinsic inflammation of cystic fibrosis airways.
17389786 2007 Coincident activation of Th2 T cells with onset of the disease and differential expression of GRO-gamma in peripheral blood leukocytes in minimal change disease.
16356540 2006 Detection of up-regulated genes in thrombin-stimulated human umbilical vein endothelial cells.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12734364 2003 The Toll-like receptor 5 stimulus bacterial flagellin induces maturation and chemokine production in human dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10095777 1999 Isolation of the CXC chemokines ENA-78, GRO alpha and GRO gamma from tumor cells and leukocytes reveals NH2-terminal heterogeneity. Functional comparison of different natural isoforms.
9873037 1999 Agonists and inverse agonists for the herpesvirus 8-encoded constitutively active seven-transmembrane oncogene product, ORF-74.
9322516 1997 Differential and regulated expression of C-X-C, C-C, and C-chemokines by human colon epithelial cells.
9277410 1997 Human hepatocytes express an array of proinflammatory cytokines after agonist stimulation or bacterial invasion.
8702798 1996 The CXC chemokines growth-regulated oncogene (GRO) alpha, GRObeta, GROgamma, neutrophil-activating peptide-2, and epithelial cell-derived neutrophil-activating peptide-78 are potent agonists for the type B, but not the type A, human interleukin-8 receptor.
8344798 1993 Expression of three forms of melanoma growth stimulating activity (MGSA)/gro in human retinal pigment epithelial cells.
8166297 1994 Constitutive and stimulated MCP-1, GRO alpha, beta, and gamma expression in human airway epithelium and bronchoalveolar macrophages.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
2217207 1990 Identification of three related human GRO genes encoding cytokine functions.
2201751 1990 Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.
2129556 1990 Nucleotide sequence of the human melanoma growth stimulatory activity (MGSA) gene.
1906501 1991 An NF-kappa B-like transcription factor mediates IL-1/TNF-alpha induction of gro in human fibroblasts.