Property Summary

NCBI Gene PubMed Count 39
Grant Count 5
R01 Count 3
Funding $463,641.72
PubMed Score 74.67
PubTator Score 41.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -3.900 0.000
Barrett's esophagus 1.700 0.035
esophageal adenocarcinoma 2.000 0.025
posterior fossa group A ependymoma 3.500 0.000
cystic fibrosis 3.300 0.001
tuberculosis -5.100 0.000
non-small cell lung cancer -2.788 0.000
intraductal papillary-mucinous adenoma (... 1.800 0.005
intraductal papillary-mucinous neoplasm ... 1.900 0.018
colon cancer 2.000 0.035
lung cancer -5.500 0.000
active Crohn's disease 3.572 0.015
ulcerative colitis 5.100 0.000
pancreatic cancer 2.100 0.000
interstitial cystitis 1.500 0.029
nasopharyngeal carcinoma 1.300 0.010
lung adenocarcinoma -1.465 0.000
spina bifida -1.544 0.027
gastric carcinoma 2.700 0.031
ovarian cancer 1.200 0.017
head and neck cancer 1.900 0.000
psoriasis 2.100 0.000

Synonym

Accession P19876 Q4W5H9
Symbols GRO3
GROg
MIP2B
SCYB3
MIP-2b
CINC-2b

Gene

Gene RIF (20)

PMID Text
24605943 results support a functional role of CXCL3 in breast cancer metastasis and as a viable target for cancer therapy
23904157 our results demonstrate the diverse mechanisms by which CXCL2 and CXCL3 mediate normal and asthmatic airway smooth muscle cell migration
23589610 secreted growth-regulated oncogene chemokines, specifically GRO-gamma, in human Mesenchymal stromal cell-conditioned media have an effect on the differentiation and the function of human monocyte-derived dendritic cells.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of chemokine (C-X-C motif) ligand 3 (CXCL3) in peptide-treated PBMCs
23225384 This study demonistrated that CXCL1, CXCL2, CXCL3, CXCL8, and CXCL11, absent from normal muscle fibers, were induced in DMD myofibers.
23023221 Data show that mesenchymal stem cells (MSCs) directly regulate T cell proliferation by induction of CXCL3 chemokine and its receptor, CXCR2 on the surface in T cells.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20162422 A significantly increased expression of GRO-2, GRO-3, and IL-8 in colon carcinoma as compared to normal tissue, is reported.
More...

AA Sequence

MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCA      1 - 70
QTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN                                      71 - 107
//

Text Mined References (40)

PMID Year Title
24605943 2014 CXCL3 is a potential target for breast cancer metastasis.
23904157 2013 Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration.
23589610 2013 Mesenchymal stem cells tune the development of monocyte-derived dendritic cells toward a myeloid-derived suppressive phenotype through growth-regulated oncogene chemokines.
23225384 2012 Upregulation of chemokines and their receptors in Duchenne muscular dystrophy: potential for attenuation of myofiber necrosis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23023221 2012 Mesenchymal stem cells regulate the proliferation of T cells via the growth-related oncogene/CXC chemokine receptor, CXCR2.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20162422 2010 Differential expression of the chemokines GRO-2, GRO-3, and interleukin-8 in colon cancer and their impact on metastatic disease and survival.
More...