Property Summary

NCBI Gene PubMed Count 75
PubMed Score 241.65
PubTator Score 242.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (34)

Disease log2 FC p
active Crohn's disease 4.056 1.7e-02
active ulcerative colitis 3.463 1.9e-02
acute myeloid leukemia 2.600 3.5e-02
adrenocortical carcinoma -1.712 3.0e-02
Barrett's esophagus 1.600 4.2e-02
Bipolar Disorder 2.607 4.0e-02
Breast cancer -3.100 4.8e-02
breast carcinoma -2.300 4.3e-04
chronic rhinosinusitis -1.972 8.2e-03
colon cancer 1.800 2.9e-02
cutaneous lupus erythematosus 1.600 2.3e-02
cystic fibrosis 3.790 4.3e-04
ependymoma 2.800 2.6e-06
esophageal adenocarcinoma 1.800 3.0e-02
gastric carcinoma 3.700 1.1e-02
group 4 medulloblastoma -1.200 9.4e-04
head and neck cancer 1.100 2.6e-04
hepatocellular carcinoma -1.600 4.3e-02
interstitial cystitis 1.200 1.1e-02
lung adenocarcinoma -1.300 6.7e-06
lung cancer -6.300 6.7e-08
lung carcinoma -3.400 6.4e-15
malignant mesothelioma -4.900 5.6e-09
medulloblastoma, large-cell -1.200 6.4e-05
nephrosclerosis -2.203 4.3e-04
non-small cell lung cancer -1.392 1.8e-13
ovarian cancer 1.800 3.7e-02
pancreatic ductal adenocarcinoma liver m... -2.021 1.0e-03
pediatric high grade glioma 1.100 4.9e-02
Pick disease -1.200 1.5e-02
psoriasis 1.600 6.6e-05
remitted schizophrenia patient 1.500 1.9e-02
spina bifida -1.946 2.6e-02
tuberculosis -2.000 7.2e-03

 IMPC Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (47)

AA Sequence

MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA      1 - 70
QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN                                      71 - 107
//

Text Mined References (75)

PMID Year Title