Property Summary

NCBI Gene PubMed Count 71
PubMed Score 214.23
PubTator Score 242.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 6.77733672616198E-123
Breast cancer 3099 1.16813178074444E-40
breast carcinoma 1614 1.48703409497799E-28
non-small cell lung cancer 2798 4.97623808221466E-20
lung carcinoma 2844 6.37426696662691E-15
posterior fossa group A ependymoma 1511 1.62295005226826E-12
ulcerative colitis 2087 3.47762973250966E-12
malignant mesothelioma 3163 5.56993249318775E-9
lung cancer 4473 2.94486874507537E-7
lung adenocarcinoma 2714 3.90059481266013E-6
medulloblastoma, large-cell 6234 6.38226477769699E-5
tuberculosis 1563 2.03852326831148E-4
cystic fibrosis 1670 4.26681199201703E-4
nephrosclerosis 329 4.29410301959786E-4
group 4 medulloblastoma 1875 9.37580384516944E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 9.96200260166843E-4
interstitial cystitis 2299 0.00229394426803038
head and neck cancer 270 0.00412440360444611
chronic rhinosinusitis 512 0.0081637684759277
gastric carcinoma 832 0.0112728262216287
Pick disease 1893 0.015078963026191
active Crohn's disease 918 0.0173471037977681
remitted schizophrenia patient 3 0.0191036004731012
cutaneous lupus erythematosus 1056 0.0229588614625265
spina bifida 1064 0.0258030896312883
colon cancer 1475 0.0288087862643256
adrenocortical carcinoma 1427 0.0301905553624492
esophageal adenocarcinoma 737 0.0302628726224662
acute myeloid leukemia 785 0.0348535100115971
ovarian cancer 8492 0.0368455788117282
Bipolar Disorder 266 0.0404055593632203
Barrett's esophagus 185 0.0418064616036812
hepatocellular carcinoma 550 0.0428570831516872
pediatric high grade glioma 2712 0.0494859349817605

Expression

  Differential Expression (34)

Disease log2 FC p
nephrosclerosis -2.203 0.000
hepatocellular carcinoma -1.600 0.043
malignant mesothelioma -4.900 0.000
remitted schizophrenia patient 1.500 0.019
Barrett's esophagus 1.600 0.042
esophageal adenocarcinoma 1.800 0.030
psoriasis 3.400 0.000
cutaneous lupus erythematosus 1.600 0.023
posterior fossa group A ependymoma 4.200 0.000
cystic fibrosis 3.790 0.000
medulloblastoma, large-cell -1.200 0.000
adrenocortical carcinoma -1.712 0.030
tuberculosis -3.300 0.000
pancreatic ductal adenocarcinoma liver m... -2.021 0.001
non-small cell lung cancer -3.707 0.000
colon cancer 1.800 0.029
lung cancer -7.500 0.000
active Crohn's disease 4.056 0.017
ulcerative colitis 5.300 0.000
breast carcinoma -2.500 0.000
Breast cancer -5.100 0.000
interstitial cystitis 2.300 0.002
lung adenocarcinoma -2.581 0.000
pediatric high grade glioma 1.100 0.049
group 4 medulloblastoma -1.200 0.001
lung carcinoma -3.400 0.000
spina bifida -1.946 0.026
Pick disease -1.200 0.015
gastric carcinoma 3.700 0.011
Bipolar Disorder 2.607 0.040
acute myeloid leukemia 2.600 0.035
ovarian cancer 1.800 0.037
chronic rhinosinusitis -1.972 0.008
head and neck cancer 2.500 0.004

Synonym

Accession P19875 Q6FGD6 Q9UPB8
Symbols GRO2
GROb
MIP2
MIP2A
SCYB2
MGSA-b
MIP-2a
CINC-2a

Gene

PDB

1QNK  

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (43)

PMID Text
26345899 Polymorphisms in the promoter regions of the CXCL1 and CXCL2 genes contribute to increased risk of alopecia areata in the Korean population
26063953 high GRO-beta expression correlates with poor prognosis and contributes to ovarian cancer tumorigenesis and metastasis.
25802102 The results link CXCL1 and CXCL2 chemokines with bone marrow adiposity and implicate CXCR2 signaling in promoting effects of marrow fat on progression of skeletal tumors in bone.
25801245 We have demonstrated that GRObeta, as an oncogene product, contributed to tumorigenesis and metastasis of HCC
25708728 autophagy is required for Hepatitis B virus-induced NF-kappaB activation and release of IL-6, IL-8, and CXCL2 in Hepatocytes
25682075 Our results demonstrated that resistance to anti-proliferative effects of CXCR2 may also arise from feedback increases in MIP-2 secretion.
25085744 In this review, a genetic variant in CXCL12 is described that is associated with type 2 diabetes mellitus and its complications.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 2 (CXCL2) in primary human brain microvascular endothelial cells
24098805 Simultaneous targeting of hCAP-G2 and MIP-2A is a promising strategy for the development of antitumor drugs as a treatment for intractable tumours.
23904157 our results demonstrate the diverse mechanisms by which CXCL2 and CXCL3 mediate normal and asthmatic airway smooth muscle cell migration
More...

AA Sequence

MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA      1 - 70
QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN                                      71 - 107
//

Text Mined References (71)

PMID Year Title
26345899 2015 Polymorphisms in the promoter regions of the CXCL1 and CXCL2 genes contribute to increased risk of alopecia areata in the Korean population.
26063953 2015 Overexpression of Growth-Related Oncogene-? Is Associated with Tumorigenesis, Metastasis, and Poor Prognosis in Ovarian Cancer.
25802102 2015 Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer.
25801245 2015 Clinical significance of serum expression of GRO? in hepatocellular carcinoma.
25708728 2015 Autophagy Mediates HBx-Induced Nuclear Factor-?B Activation and Release of IL-6, IL-8, and CXCL2 in Hepatocytes.
25682075 2015 Autocrine control of MIP-2 secretion from metastatic breast cancer cells is mediated by CXCR2: a mechanism for possible resistance to CXCR2 antagonists.
25085744 2015 Significance of CXCL12 in type 2 diabetes mellitus and its associated complications.
24098805 2013 MIP-2A is a novel target of an anilinoquinazoline derivative for inhibition of tumour cell proliferation.
23904157 2013 Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration.
23554905 2013 RNA-seq reveals activation of both common and cytokine-specific pathways following neutrophil priming.
More...