Property Summary

NCBI Gene PubMed Count 2,381
Grant Count 249
R01 Count 178
Funding $22,301,697.3
PubMed Score 462.21
PubTator Score 7253.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.200 0.015
tuberculosis -2.400 0.000
lung cancer -1.300 0.001
diabetes mellitus -1.200 0.007

Synonym

Accession P19838 A8K5Y5 B3KVE8 Q68D84 Q86V43 Q8N4X7 Q9NZC0
Symbols p50
KBF1
p105
EBP-1
CVID12
NF-kB1
NFKB-p50
NFkappaB
NF-kappaB
NFKB-p105
NF-kappa-B

Gene

PANTHER Protein Class (1)

PDB

1NFI   2O61   1MDI   1MDJ   1MDK   3GUT   1SVC   2DBF  

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
895 confirmatory 80 / 820 / 379 qHTS Assay for Identification of Small Molecule Antagonists for NFkB Signaling Pathway
928 confirmatory 4 / 896 / 379 qHTS Assay for Identification of Small Molecule Agonists for NFkB Signaling Pathway
1239 screening 3101 / 1 / 190195 High Throughput Screen to Identify Compounds that increase expression of NF-kB in Human Neuronal Cells - Primary Screen
1241 confirmatory 842 / 0 / 400 Name: High Throughput Screen to Identify Compounds that increase expression of NF-kB in Human Neuronal Cells - Dose Response
1308 screening 438 / 0 / 777 Counterscreen assay for STAT3 inhibitors: Cell-based high throughput assay to measure NF-kappaB inhibition.
1309 screening 132 / 0 / 1065 Counterscreen assay for STAT3 activators: Cell-based high throughput assay to measure NF-kappaB activation
652028 other 1 / 0 / 10 Late stage assay provider counterscreen results from the probe development effort to identify STAT5 inhibitors: luminescence-based cell-based reporter assay to identify inhibitors of NFkB signaling

Gene RIF (2468)

PMID Text
27348973 the RRM2/AKT/NF-kappaB signaling pathway is essential for tumor invasiveness in gastric cancer cells
27090786 Data show that genetic ablation of Toll-like receptor 2 (TLR2) by siRNA and TLR2-neutralizing antibody could block NF-kappa B (NF-kappaB) activation by exosomes.
26995963 Selective regulation of NF-kappaB gene targets may indicate involvement of ACTN4 in determining the specificity of cell response to NF-kappaB activation in cells of different types. (Review)
26944017 TAK-242 also significantly suppressed the expression of TLR4, MyD88 and the activation of NF-kappaB in lungs, suggesting that TAK-242-mediated inhibition occurred largely through the TLR4/NF-kappaB signal pathway.
26927557 Data indicate the hypercoagulable state is common in the peripheral blood of rheumatoid arthritis patients, and it is closely related to inflammatory factors, activity indexes and abnormal activation of NF-kappa B.
26914121 The NFkappaB signaling pathway is significantly associated with the development of laryngeal squamous cell carcinoma.
26903652 Data indicate that endoplasmic reticulum (ER) stress increase sphingosine-1-phosphate (S1P) production, in turn activating nuclear factor kappa B (NF-kappaB)-mediated cathelicidin antimicrobial peptide (CAMP) synthesis.
26892811 role of canonical NF-kappaB signaling in hepatocellular carcinoma development depends on the mode of liver damage
26891870 ZBP-89 and NF-kappa B bind cooperatively to the MMP-1 promoter.
26879815 Reported is the distribution of allelic and genotypic frequencies of IL1A, IL4, NFKB1 and PAR1 variants in Native American, African, and European populations of Brazil and their association with predisposition to cancer.
More...

AA Sequence

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLP      1 - 70
GASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLG     71 - 140
ILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLS    141 - 210
VVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDI    211 - 280
QIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYY    281 - 350
PEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH    351 - 420
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTK    421 - 490
EESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVR    491 - 560
DLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKV    561 - 630
LSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISL    631 - 700
AGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVV    701 - 770
PGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG    771 - 840
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPAS    841 - 910
TRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI                911 - 968
//

Text Mined References (2399)

PMID Year Title
27348973 2016 Overexpression of RRM2 in gastric cancer cell promotes their invasiveness via AKT/NF-?B signaling pathway.
27090786 2016 Lung tumor exosomes induce a pro-inflammatory phenotype in mesenchymal stem cells via NF?B-TLR signaling pathway.
26995963 2015 [ALPHA-ACTININS AND SIGNAL TRANSDUCTION PATHWAYS].
26944017 2016 TAK-242 attenuates acute cigarette smoke-induced pulmonary inflammation in mouse via the TLR4/NF-?B signaling pathway.
26927557 2016 [Hypercoagulable state is associated with NF-kappa B activation and increased inflammatory factors in patients with rheumatoid arthritis].
26914121 2016 Laryngeal squamous cell carcinoma progression is associated with the NF?B signaling pathway regulated by I?B kinase ?.
26903652 2016 ER stress stimulates production of the key antimicrobial peptide, cathelicidin, by forming a previously unidentified intracellular S1P signaling complex.
26892811 2016 Canonical NF-?B signaling in hepatocytes acts as a tumor-suppressor in hepatitis B virus surface antigen-driven hepatocellular carcinoma by controlling the unfolded protein response.
26891870 2016 Zinc-binding protein-89 (ZBP-89) cooperates with NF-?B to regulate expression of matrix metalloproteinases (MMPs) in response to inflammatory cytokines.
26879815 2016 Distribution of allelic and genotypic frequencies of IL1A, IL4, NFKB1 and PAR1 variants in Native American, African, European and Brazilian populations.
More...