Property Summary

Ligand Count 10
NCBI Gene PubMed Count 2,574
PubMed Score 505.02
PubTator Score 7253.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
tuberculosis 2010 5.2e-09
lung cancer 4740 7.1e-04
diabetes mellitus 1728 7.0e-03
glioblastoma 5792 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Schizophrenia 1160 0.0 2.4
Disease Target Count Z-score Confidence
Cancer 2499 4.607 2.3
Inflammatory bowel disease 151 3.079 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.200 7.0e-03
glioblastoma 1.200 1.5e-02
lung cancer -1.300 7.1e-04
tuberculosis -2.400 5.2e-09

Protein-protein Interaction (4)

Gene RIF (2604)

AA Sequence

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLP      1 - 70
GASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLG     71 - 140
ILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLS    141 - 210
VVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDI    211 - 280
QIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYY    281 - 350
PEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH    351 - 420
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTK    421 - 490
EESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVR    491 - 560
DLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKV    561 - 630
LSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISL    631 - 700
AGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVV    701 - 770
PGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG    771 - 840
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPAS    841 - 910
TRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI                911 - 968
//

Text Mined References (2592)

PMID Year Title