Property Summary

Ligand Count 5
NCBI Gene PubMed Count 76
PubMed Score 373.76
PubTator Score 542.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 1.100 1.6e-03
interstitial cystitis -1.100 3.0e-02
intraductal papillary-mucinous adenoma (... -10.200 3.1e-08
intraductal papillary-mucinous carcinoma... -10.400 1.7e-08
intraductal papillary-mucinous neoplasm ... -10.200 9.9e-06
lung cancer 1.200 1.4e-02
malignant mesothelioma 1.100 2.4e-03
non-small cell lung cancer 1.128 1.8e-04
pancreatic cancer -3.100 3.3e-02
pituitary cancer -5.800 1.6e-12
psoriasis -1.600 1.2e-29
pterygium -1.900 1.8e-02

Gene RIF (33)

AA Sequence

MGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTKALENPQPHPG      1 - 70
WQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFL     71 - 140
NNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITL    141 - 210
FGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKV    211 - 280
TDPRALTLAYKVPLAGLEYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMP    281 - 350
AINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIA    351 - 420
LAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTN    421 - 490
FAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPV    491 - 560
PPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTG    561 - 630
DSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGA    631 - 700
PPVTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF                     701 - 753
//

Text Mined References (77)

PMID Year Title