Property Summary

NCBI Gene PubMed Count 73
Grant Count 47
R01 Count 34
Funding $8,019,418.16
PubMed Score 363.07
PubTator Score 542.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (30)

PMID Text
26498142 Data show that the c.1719C > T transition (single nucleotide polymorphism rs488087) present in bile salt-dependent lipase (BSDL) VNTR may be a useful marker for defining a population at risk of developing pancreatic cancer (PC)
25774637 Expression of CEL-HYB in originating from a crossover between CEL and its neighboring pseudogene, CELP is associated with chronic pancreatitis.
25160620 secreted carboxyl ester lipase has a role in a syndrome of diabetes and pancreatic exocrine dysfunction
24062244 subjects with CEL-maturity-onset diabetes of the young develop multiple pancreatic cysts by the time they develop diabetes. upregulated MAPK signaling in the pancreas may reflect the pathophysiological development of pancreatic cysts and diabetes.
23770712 CEL-MODY patients with a mutation in the variable number of tandem repeat region in exon 11 of the CEL gene displayed severely reduced acinar function and moderately reduced ductal function of the pancreas compared with control subjects.
23395566 This study did not find evidence that supported an association between the common length variations of the CEL VNTR and chronic pancreatitis.
22956586 Monoclonal antibody 16D10 inhibits the proliferation of human pancreatic tumor cells expressing 16D10 plasma membrane antigen.
22412885 We identify BSSL as a marker for HIV-1 disease progression and emergence of X4 variants. Additionally, we identified a relation between BSSL genotype and CD4 cell counts prior to infection.
21865348 BSSL and PLRP2 hydrolyzed triglycerides (TG) to free FA and glycerol.
21784842 CEL-MUT protein has a high propensity to form aggregates found intracellularly and extracellularly; CEL-MODY is a protein misfolding disease
More...

AA Sequence

MGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTKALENPQPHPG      1 - 70
WQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFL     71 - 140
NNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITL    141 - 210
FGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKV    211 - 280
TDPRALTLAYKVPLAGLEYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMP    281 - 350
AINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIA    351 - 420
LAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTN    421 - 490
FAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPV    491 - 560
PPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTG    561 - 630
DSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGA    631 - 700
PPVTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF                     701 - 753
//

Text Mined References (74)

PMID Year Title
26498142 2015 Rs488087 single nucleotide polymorphism as predictive risk factor for pancreatic cancers.
25774637 2015 A recombined allele of the lipase gene CEL and its pseudogene CELP confers susceptibility to chronic pancreatitis.
25160620 2014 Endocytosis of secreted carboxyl ester lipase in a syndrome of diabetes and pancreatic exocrine dysfunction.
24062244 2014 Carboxyl-ester lipase maturity-onset diabetes of the young is associated with development of pancreatic cysts and upregulated MAPK signaling in secretin-stimulated duodenal fluid.
23770712 2013 Severe pancreatic dysfunction but compensated nutritional status in monogenic pancreatic disease caused by carboxyl-ester lipase mutations.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23395566 The number of tandem repeats in the carboxyl-ester lipase (CEL) gene as a risk factor in alcoholic and idiopathic chronic pancreatitis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22956586 2012 Targeting a novel onco-glycoprotein antigen at tumoral pancreatic cell surface by mAb16D10 induces cell death.
22412885 2012 HIV-1 disease progression is associated with bile-salt stimulated lipase (BSSL) gene polymorphism.
More...