Property Summary

NCBI Gene PubMed Count 36
Grant Count 1
Funding $58,785
PubMed Score 16.73
PubTator Score 10.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.038 0.020
lung cancer -1.300 0.046
sonic hedgehog group medulloblastoma 2.400 0.002
ovarian cancer 1.300 0.000

Gene RIF (8)

PMID Text
26728454 Data suggest that Mg2+ or Mn2+ (but not Ca2+) induce a conformational change in inter-alpha-inhibitor (ITIH1 and ITIH2) and a bikunin/chondroitin sulfate-dependent increase in thermodynamic stability; bikunin binds adjacent to the two heavy chains.
21939789 Human inter-alpha-inhibitor is a substrate for factor XIIIa and tissue transglutaminase.
20297716 It forms complex with hyaluronan and the comlex is a functional molecule involved in inflammation.
18425383 serum-derived hyaluronan-associated protein-hyaluronan complex has a role in progression of ovarian cancer
18382897 Increased levels of SHAP-HA complex in sera are possible predictive markers for cervical ripening in premature labor.
16702221 Leukocytes infiltrated to the synovium were strongly positive for hyaluronic acid, SHAP, and CD44 on their surfaces, suggesting a role for the adhesion-enhancing effect of SHAP in inflammation.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15840581 TSG-6 acts as cofactor and catalyst in the production of IalphaI heavy chain x hyaluronan complexes

AA Sequence

MKRLTCFFICFFLSEVSGFEIPINGLSEFVDYEDLVELAPGKFQLVAENRRYQRSLPGESEEMMEEVDQV      1 - 70
TLYSYKVQSTITSRMATTMIQSKVVNNSPQPQNVVFDVQIPKGAFISNFSMTVDGKTFRSSIKEKTVGRA     71 - 140
LYAQARAKGKTAGLVRSSALDMENFRTEVNVLPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLE    141 - 210
VDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRETAVDGELVVLYDVK    211 - 280
REEKAGELEVFNGYFVHFFAPDNLDPIPKNILFVIDVSGSMWGVKMKQTVEAMKTILDDLRAEDHFSVID    281 - 350
FNQNIRTWRNDLISATKTQVADAKRYIEKIQPSGGTNINEALLRAIFILNEANNLGLLDPNSVSLIILVS    351 - 420
DGDPTVGELKLSKIQKNVKENIQDNISLFSLGMGFDVDYDFLKRLSNENHGIAQRIYGNQDTSSQLKKFY    421 - 490
NQVSTPLLRNVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGKFDPAKLDQIESVITATSANTQLVLETLA    491 - 560
QMDDLQDFLSKDKHADPDFTRKLWAYLTINQLLAERSLAPTAAAKRRITRSILQMSLDHHIVTPLTSLVI    561 - 630
ENEAGDERMLADAPPQDPSCCSGALYYGSKVVPDSTPSWANPSPTPVISMLAQGSQVLESTPPPHVMRVE    631 - 700
NDPHFIIYLPKSQKNICFNIDSEPGKILNLVSDPESGIVVNGQLVGAKKPNNGKLSTYFGKLGFYFQSED    701 - 770
IKIEISTETITLSHGSSTFSLSWSDTAQVTNQRVQISVKKEKVVTITLDKEMSFSVLLHRVWKKHPVNVD    771 - 840
FLGIYIPPTNKFSPKAHGLIGQFMQEPKIHIFNERPGKDPEKPEASMEVKGQKLIITRGLQKDYRTDLVF    841 - 910
GTDVTCWFVHNSGKGFIDGHYKDYFVPQLYSFLKRP                                      911 - 946
//

Text Mined References (42)

PMID Year Title
26728454 2016 The Compact and Biologically Relevant Structure of Inter-?-inhibitor Is Maintained by the Chondroitin Sulfate Chain and Divalent Cations.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22116950 2012 Genetic variants and environmental factors associated with hormonal markers of ovarian reserve in Caucasian and African American women.
21939789 2011 Human inter-?-inhibitor is a substrate for factor XIIIa and tissue transglutaminase.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...