Property Summary

Ligand Count 12
NCBI Gene PubMed Count 46
PubMed Score 589.97
PubTator Score 1164.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis 1.300 3.9e-03
Barrett's esophagus 3.100 3.0e-02
colon cancer -1.700 1.2e-03
esophageal adenocarcinoma 3.300 1.9e-02
interstitial cystitis 1.400 8.5e-03
intraductal papillary-mucinous adenoma (... 3.700 4.6e-05
intraductal papillary-mucinous carcinoma... 3.900 2.0e-03
intraductal papillary-mucinous neoplasm ... 3.900 8.8e-04
lung cancer 1.100 2.0e-03
nephrosclerosis -2.490 3.0e-02
osteosarcoma -2.647 2.3e-07
ovarian cancer 1.300 5.7e-04
pancreatic cancer 3.000 3.3e-06
ulcerative colitis -1.300 5.9e-04

Gene RIF (21)

AA Sequence

MPALGWAVAAILMLQTAMAEPSPGTLPRKAGVFSDLSNQELKAVHSFLWSKKELRLQPSSTTTMAKNTVF      1 - 70
LIEMLLPKKYHVLRFLDKGERHPVREARAVIFFGDQEHPNVTEFAVGPLPGPCYMRALSPRPGYQSSWAS     71 - 140
RPISTAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGY    141 - 210
FLHPTGLELLVDHGSTDAGHWAVEQVWYNGKFYGSPEELARKYADGEVDVVVLEDPLPGGKGHDSTEEPP    211 - 280
LFSSHKPRGDFPSPIHVSGPRLVQPHGPRFRLEGNAVLYGGWSFAFRLRSSSGLQVLNVHFGGERIAYEV    281 - 350
SVQEAVALYGGHTPAGMQTKYLDVGWGLGSVTHELAPGIDCPETATFLDTFHYYDADDPVHYPRALCLFE    351 - 420
MPTGVPLRRHFNSNFKGGFNFYAGLKGQVLVLRTTSTVYNYDYIWDFIFYPNGVMEAKMHATGYVHATFY    421 - 490
TPEGLRHGTRLHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYS    491 - 560
WERQAAFRFKRKLPKYLLFTSPQENPWGHKRTYRLQIHSMADQVLPPGWQEEQAITWARYPLAVTKYRES    561 - 630
ELCSSSIYHQNDPWHPPVVFEQFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFN    631 - 700
FFPEDPSLASRDTVIVWPRDNGPNYVQRWIPEDRDCSMPPPFSYNGTYRPV                       701 - 751
//

Text Mined References (47)

PMID Year Title