Property Summary

NCBI Gene PubMed Count 46
Grant Count 55
R01 Count 30
Funding $7,297,323.68
PubMed Score 552.04
PubTator Score 1164.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (21)

PMID Text
25909280 HRH1-17 TT and HNMT-1639 TT genotypes were associated with the allergic asthma phenotype among African-American children and that the ABP 4107 GG genotype was associated with nonallergic asthma among white children.
25612138 This study findings suggest that DAO genotypes and allelic variants are associated with the risk for migraine in Caucasian Spanish people, especially in women.
23099198 Serum diamine oxidase levels were influenced by the menstrual cycle.
22433290 Low diamine oxidase activity is associated with gastrointestinal tract toxicities during chemotherapy with oral fluorouracil anti-cancer drugs in patients with gastric cancer.(
21488903 Diamine oxidase (DAO) variants were not associated with the histamine intolerance (HIT) phenotype per se, only with DAO activity alone and the subgroup of HIT patients displaying a reduced DAO activity.
21225906 Low serum diamine oxidase activity in inflammatory bowel disease.
21040557 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20124708 structure of human DAO refined to 2.1 A resolution in space group C222(1) with one molecule in the asymmetric unit is reported.
19764817 An aspartic acid residue, conserved in all diamine oxidases, is responsible for the diamine specificity by interacting with the second amino group of preferred diamine substrates.
More...

AA Sequence

MPALGWAVAAILMLQTAMAEPSPGTLPRKAGVFSDLSNQELKAVHSFLWSKKELRLQPSSTTTMAKNTVF      1 - 70
LIEMLLPKKYHVLRFLDKGERHPVREARAVIFFGDQEHPNVTEFAVGPLPGPCYMRALSPRPGYQSSWAS     71 - 140
RPISTAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGY    141 - 210
FLHPTGLELLVDHGSTDAGHWAVEQVWYNGKFYGSPEELARKYADGEVDVVVLEDPLPGGKGHDSTEEPP    211 - 280
LFSSHKPRGDFPSPIHVSGPRLVQPHGPRFRLEGNAVLYGGWSFAFRLRSSSGLQVLNVHFGGERIAYEV    281 - 350
SVQEAVALYGGHTPAGMQTKYLDVGWGLGSVTHELAPGIDCPETATFLDTFHYYDADDPVHYPRALCLFE    351 - 420
MPTGVPLRRHFNSNFKGGFNFYAGLKGQVLVLRTTSTVYNYDYIWDFIFYPNGVMEAKMHATGYVHATFY    421 - 490
TPEGLRHGTRLHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYS    491 - 560
WERQAAFRFKRKLPKYLLFTSPQENPWGHKRTYRLQIHSMADQVLPPGWQEEQAITWARYPLAVTKYRES    561 - 630
ELCSSSIYHQNDPWHPPVVFEQFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFN    631 - 700
FFPEDPSLASRDTVIVWPRDNGPNYVQRWIPEDRDCSMPPPFSYNGTYRPV                       701 - 751
//

Text Mined References (47)

PMID Year Title
25909280 2015 Genetic Variation along the Histamine Pathway in Children with Allergic versus Nonallergic Asthma.
25612138 2015 Diamine oxidase?rs10156191 and rs2052129 variants are associated with the risk for migraine.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23099198 2013 Effect of the menstrual cycle on serum diamine oxidase levels in healthy women.
22433290 2012 Plasma diamine oxidase activity is a useful biomarker for evaluating gastrointestinal tract toxicities during chemotherapy with oral fluorouracil anti-cancer drugs in patients with gastric cancer.
21488903 2011 Association of single nucleotide polymorphisms in the diamine oxidase gene with diamine oxidase serum activities.
21225906 2011 Clinical significance of serum diamine oxidase activity in inflammatory bowel disease: Importance of evaluation of small intestinal permeability.
More...