Property Summary

NCBI Gene PubMed Count 294
Grant Count 135
R01 Count 82
Funding $11,081,296.32
PubMed Score 228.62
PubTator Score 1398.44

Knowledge Summary

Patent (8,536)

Expression

  Differential Expression (12)

Synonym

Accession P19793 B3KY83 Q2NL52 Q2V504
Symbols NR2B1

Gene

PDB

3R29   3R2A   1XV9   1XVP   1FM6   1FM9   1K74   1RDT   3DZU   3DZY   3E00   3H0A   1YNW   4J5W   4J5X   1DSZ   2NLL   4ZO1   1MV9   1MVC   1MZN   2P1T   2P1U   2P1V   2ZXZ   2ZY0   3E94   3FUG   3KWY   3OAP   3OZJ   3PCU   3R5M   4K4J   4K6I   4M8E   4M8H   4NQA   4OC7   4POH   4POJ   4PP3   4PP5   4RFW   4RMC   4RMD   4RME   4ZSH   5EC9   1BY4   1FBY   1G1U   1G5Y   1LBD   1R0N   1RXR   1XLS   2ACL   3FAL   3FC6   3NSP   3NSQ   3UVV   4CN2   4CN3   4CN5   4CN7   4N5G   4N8R  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (177)

PMID Text
26883505 Results suggest that retinoid X receptor (RXR) activation protects retinal pigment epithelium (RPE) cells from oxidative stress-induced apoptosis.
26727233 Studied role of RXRalpha in downregulating hepatic detoxification during inflammation elicited by circulating cytokines.
26644513 Vitamin D receptor-retinoid X receptor heterodimer signaling regulates oligodendrocyte progenitor cell differentiation
26610845 RXRA rs10776909 allele T is specifically involved in the pathogenesis of ChGN. This risk allele may be also associated with worse clinical course of ChGN.
26463675 results reveal the retinoid X receptor pathway as a positive regulator of myelin debris clearance and a key player in the age-related decline in remyelination.
26447153 genetic association study in population in France: Data suggest 2 genetic polymorphisms (RXRA, rs7861779; VDR Fok1 [vitamin D receptor Fok1], rs2228570) are associated with cancers related to tobacco use and vitamin D status.
26443578 A change in the heterodimeric partner of Peroxisome Proliferator Activated Receptor-alpha from retinoid X receptor to Silent information regulator 1 is responsible for the impaired fatty acid metabolism and cardiac dysfunction in the failing heart.
26355550 Data show that pregnane X receptor/retinoid X receptor PXR/RXR-[alpha], RXR-[beta], or RXR-[gamma] expression was noted in 9 (16.4%), 9 (16.4%), and 10 (18.2%) pancreatic adenocarcinoma cases, respectively.
26310932 Retinoid X receptor alpha plays an important role in proliferation of cholangiocarcinoma
26289479 These findings define rules guiding how nuclear receptors integrate two ligand-dependent signalling pathways into RXR heterodimer-specific responses.
More...

AA Sequence

MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISS      1 - 70
PMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGD     71 - 140
RSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQ    141 - 210
RGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLV    211 - 280
EWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVL    281 - 350
TELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL    351 - 420
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT                                421 - 462
//

Text Mined References (310)

PMID Year Title
26883505 2016 Protective effects of retinoid x receptors on retina pigment epithelium cells.
26727233 2016 Coordinating Role of RXR? in Downregulating Hepatic Detoxification during Inflammation Revealed by Fuzzy-Logic Modeling.
26644513 2015 Vitamin D receptor-retinoid X receptor heterodimer signaling regulates oligodendrocyte progenitor cell differentiation.
26610845 2015 Association of Retinoid X Receptor Alpha Gene Polymorphism with Clinical Course of Chronic Glomerulonephritis.
26463675 2015 Retinoid X receptor activation reverses age-related deficiencies in myelin debris phagocytosis and remyelination.
26447153 2015 Prospective associations between vitamin D status, vitamin D-related gene polymorphisms, and risk of tobacco-related cancers.
26443578 2015 Peroxisome Proliferator Activated Receptor-? Association With Silent Information Regulator 1 Suppresses Cardiac Fatty Acid Metabolism in the Failing Heart.
26355550 2015 Pregnane X Receptor Expression in Human Pancreatic Adenocarcinoma: Associations With Clinicopathologic Parameters, Tumor Proliferative Capacity, Patients' Survival, and Retinoid X Receptor Expression.
26310932 2015 Retinoid X receptor ? enhances human cholangiocarcinoma growth through simultaneous activation of Wnt/?-catenin and nuclear factor-?B pathways.
26289479 2015 Structural mechanism for signal transduction in RXR nuclear receptor heterodimers.
More...