Property Summary

NCBI Gene PubMed Count 165
Grant Count 34
R01 Count 25
Funding $3,377,497.9
PubMed Score 216.59
PubTator Score 26.07

Knowledge Summary

Patent (7,051)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.200 0.005
intraductal papillary-mucinous carcinoma... -1.100 0.006
intraductal papillary-mucinous neoplasm ... -1.100 0.013
diabetes mellitus -1.100 0.001
ovarian cancer -1.700 0.000

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (56)

PMID Text
26430962 results suggest that CK2alpha might play an oncogenic role in hepatocellular carcinoma
25936516 We conclude that this class of chimeric peptides, in addition to altering some properties of CK2 holoenzyme, affects several other cellular targets, causing profound perturbations of cell biology
25788269 CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and may have role in malignant B-cell growth.
25486430 we propose that Foxc2 is functionally maintained in the cytoplasm of normal epithelial cells by CK2alpha/alpha'-mediated phosphorylation at serine 124, which is dependent on proper targeting of the holoenzyme via the CK2b regulatory subunit.
25422081 Over-expressed CK2alpha positively regulate Hh/Gli1 signaling in human mesothelioma.
25272055 Data suggest casein kinase II (CK2) inhibitors indeno[1,2-b]indole-9,10-dione, which also inhibited the breast cancer resistance protein ABCG2, might be a good therapeutic strategy to improve anticancer drug efficiency.
24795349 CSNK2A2 phosphorylates telomeric repeat binding factor 1 and plays an important role for regulation of telomere length.
23599180 CK2alpha' exhibits a striking preference for caspase-3 phosphorylation in cells as compared to CK2alpha and that CK2beta exhibits the capacity to abolish caspase-3 phosphorylation
22174317 CK2 has been shown to phosphorylate HIV-1 Matrix in vitro
21750982 Lack of DNA-PKcs is accompanied by an increase in the protein level of one of the catalytic isozymes of protein kinase CK2, i.e., CK2alpha' and a concomitant increase in CK2 activity.
More...

AA Sequence

MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKI      1 - 70
LKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYE     71 - 140
LLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMY    141 - 210
DYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRK    211 - 280
RWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR    281 - 350
//

Text Mined References (180)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26430962 2015 Protein kinase CK2? catalytic subunit is overexpressed and serves as an unfavorable prognostic marker in primary hepatocellular carcinoma.
25936516 2015 Chimeric peptides as modulators of CK2-dependent signaling: Mechanism of action and off-target effects.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25788269 2015 Protein kinase CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and propels malignant B-cell growth.
25486430 2015 Casein kinase 2 prevents mesenchymal transformation by maintaining Foxc2 in the cytoplasm.
25422081 2014 CK2?, over-expressed in human malignant pleural mesothelioma, regulates the Hedgehog signaling pathway in mesothelioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25272055 2015 Converting potent indeno[1,2-b]indole inhibitors of protein kinase CK2 into selective inhibitors of the breast cancer resistance protein ABCG2.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
More...