Property Summary

NCBI Gene PubMed Count 37
PubMed Score 78.13
PubTator Score 48.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.885 0.000
intraductal papillary-mucinous adenoma (... 2.600 0.002
psoriasis 1.500 0.000

Synonym

Accession P19652 B2R5L2 Q16571 Q5T538 Q6IB74 AGP 2
Symbols AGP2
AGP-B
AGP-B'

Gene

PDB

3APU   3APV   3APW   3APX  

Gene RIF (23)

PMID Text
25965830 Low ORM2 expression is associated with metastasis in hepatocellular carcinoma.
25408356 Data indicate that the band intensity of sialic acid content in alpha-1 Acid glycoprotein (AGP) of alcoholic liver cirrhosis was found to be lower than that in pooled control group.
24389491 These findings suggest that the ORM distal promoter region differentially regulates expression of ORM genes at basal level and in acute phase responses.
24359035 Data suggest that human serum albumin (HSA) might serve as a carrier in delivering chitooligomers to target tissues than alpha-1-glycoprotein (AGP) which has pharmacological importance.
23867815 AGP inhibits the binding of the HIV-1 gp120 consensus V3 domain (V3Cs) and macrophage inflammatory protein-1beta (MIP-1beta) to CCR5 on human monocyte-derived macrophages (MDM)
22363757 Alteration in expression of ORM2 suggests that ORM2 could be used as a potential biomarker in the diagnosis of colorectal cancer.
21638284 Identify ORM genetic variations/haplotype structure associated with serum alpha-1-acid glycoprotein level and the pharmacokinetics of paclitaxel in Japanese cancer patients.
20617306 Characterized are more than 150 human Alpha-1-acid glycoprotein isoforms, differing both in the amino acid sequence and in the glycosylation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19958090 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT      1 - 70
PNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNW     71 - 140
GLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES             141 - 201
//

Text Mined References (43)

PMID Year Title
25965830 2015 Orosomucoid 2 inhibits tumor metastasis and is upregulated by CCAAT/enhancer binding protein ? in hepatocellular carcinomas.
25408356 2015 Structural heterogeneity of glycoform of alpha-1 Acid glycoprotein in alcoholic cirrhosis patients.
24389491 2014 Distal promoter regions are responsible for differential regulation of human orosomucoid-1 and -2 gene expression and acute phase responses.
24359035 2015 Differential interactions and structural stability of chitosan oligomers with human serum albumin and ?-1-glycoprotein.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22363757 2012 The potential role of ORM2 in the development of colorectal cancer.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21638284 2011 Genetic variations of orosomucoid genes associated with serum alpha-1-acid glycoprotein level and the pharmacokinetics of paclitaxel in Japanese cancer patients.
21349832 2011 Structural insights into differences in drug-binding selectivity between two forms of human alpha1-acid glycoprotein genetic variants, the A and F1*S forms.
More...