Property Summary

NCBI Gene PubMed Count 182
Grant Count 237
R01 Count 179
Funding $22,710,011.14
PubMed Score 647.10
PubTator Score 517.36

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19634 B1ALD6 D3DPL4 Q96EM2
Symbols APNH
NHE1
LIKNS
NHE-1
PPP1R143

Gene

PDB

2E30   2BEC   1Y4E   2HTG   2KBV   2L0E   2MDF   2YGG  

Gene RIF (147)

PMID Text
27083547 Human NHE1 acts as an ERK2 membrane protein scaffold in vivo that is necessary for ERK2 activation via direct interactions, and loss of scaffolding by NHE1 leads to decreased ERK2 activation.
26821117 In human ovarian cancer cells the inducible nitric oxide synthase (iNOS) is overexpressed leading to increased formation of nitric oxide (NO). The NO promotes a glycolytic phenotype (Warburg effect) leading to H+ generation, which are removed via the sodium, proton (H+) exchanger isoform 1 (NHE1) reducing the intracellular content of this acid equivalent.
26775040 interaction of NHE1, NCX1 and CaM mediates the effects of IL6 on human hepatocellular carcinoma
26646587 Data show that both mineralcorticoid receptor (MR) and G-protein estrogen receptor (GPER) contribute to the proliferation and migration of breast and endothelial cancer cells by sodium-hydrogen exchanger 1 protein (NHE-1) upon aldosterone exposure.
26397063 the present study revealed that miR-27b is upregulated by HPV16 E7 to inhibit PPARg expression and promotes proliferation and invasion in cervical carcinoma cells.
25802333 the results support the anti-apoptotic role of HO-1 induced by NHE1 in the K562R cell line and IM-insensitive CML patients
25760855 Functional studies of N266H mutation in SLC9A1 gene showed a minor effect on the level of expression and no effect on targeting of the protein, however there was a complete absence of SLC9A1 activity.
25748234 Importantly, the specific NHE1 inhibitor cariporide reduced both three-dimensional growth and invasion independently of PDAC subtype and synergistically sensitized these behaviors to low doses of erlotinib.
25724898 CIAPIN1 over-expression decreases NHE1 expression and ERK1/2 phosphorylation.
25677682 This review focuses on the role of NHE1 and OPN in cardiac remodeling and emphasizes the signaling pathways implicating OPN in the NHE1-induced hypertrophic response.
More...

AA Sequence

MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPE      1 - 70
SRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGL     71 - 140
LVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYA    141 - 210
VCLVGGEQINNIGLLDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEF    211 - 280
ANYEHVGIVDIFLGFLSFFVVALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHL    281 - 350
SGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF    351 - 420
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITVIFF    421 - 490
TVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKK    491 - 560
CLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSAVSTVSMQNIHPKSLPSERILPALSKDKEEE    561 - 630
IRKILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRAR    631 - 700
IGSDPLAYEPKEDLPVITIDPASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETS    701 - 770
SPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ                             771 - 815
//

Text Mined References (190)

PMID Year Title
27083547 2016 The human Na(+)/H(+) exchanger 1 is a membrane scaffold protein for extracellular signal-regulated kinase 2.
26821117 2016 Are NHE1 and inducible nitric oxide synthase involved in human ovarian cancer?
26775040 2016 Na+/H+ exchanger 1, Na+/Ca2+ exchanger 1 and calmodulin complex regulates interleukin 6-mediated cellular behavior of human hepatocellular carcinoma.
26646587 2016 GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells.
26397063 2015 Elevation of miR-27b by HPV16 E7 inhibits PPAR? expression and promotes proliferation and invasion in cervical carcinoma cells.
25802333 2015 Induction of heme oxygenase-1 by Na+-H+ exchanger 1 protein plays a crucial role in imatinib-resistant chronic myeloid leukemia cells.
25760855 2015 A novel human mutation in the SLC9A1 gene results in abolition of Na+/H+ exchanger activity.
25748234 2015 A novel NHE1-centered signaling cassette drives epidermal growth factor receptor-dependent pancreatic tumor metastasis and is a target for combination therapy.
25724898 2015 CIAPIN1 targets Na?/H? exchanger 1 to mediate MDA-MB-231 cells' metastasis through regulation of MMPs via ERK1/2 signaling pathway.
25677682 2015 Targeting osteopontin, the silent partner of Na+/H+ exchanger isoform 1 in cardiac remodeling.
More...