Property Summary

NCBI Gene PubMed Count 13
Grant Count 46
R01 Count 22
Funding $5,154,140.4
PubMed Score 36.74
PubTator Score 52.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
17585781 Comparison of the structure of the human spermidine synthase with the known structure of T. maritima spermidine synthase provides a general mechanistic hypothesis for the aminopropyl transfer reaction.

AA Sequence

MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQ      1 - 70
CTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGM     71 - 140
AIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQ    141 - 210
WLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYN    211 - 280
SDVHRAAFVLPEFARKALNDVS                                                    281 - 302
//

Text Mined References (18)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17585781 2007 Structure and mechanism of spermidine synthases.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9020892 1997 Inhibition of spermidine synthase gene expression by transforming growth factor-beta 1 in hepatoma cells.
More...