Property Summary

NCBI Gene PubMed Count 49
PubMed Score 255.20
PubTator Score 86.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 1.500 3.6e-02
group 4 medulloblastoma 4.500 4.6e-04
malignant mesothelioma 2.700 6.9e-07
psoriasis 1.700 8.7e-25
subependymal giant cell astrocytoma -3.525 1.5e-03

Gene RIF (39)

AA Sequence

MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNFF      1 - 70
IDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQLLGSGSREPRQNPPCAPGAG     71 - 140
GPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQP    141 - 210
MLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQE    211 - 280
LSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE                     281 - 333
//

Text Mined References (50)

PMID Year Title