Property Summary

NCBI Gene PubMed Count 45
Grant Count 41
R01 Count 20
Funding $3,352,573.45
PubMed Score 243.89
PubTator Score 86.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 2.700 0.000
group 4 medulloblastoma 4.500 0.000
breast carcinoma 1.500 0.036
subependymal giant cell astrocytoma -3.525 0.002
psoriasis 1.700 0.000

Gene RIF (35)

PMID Text
25812440 EN2 may be a candidate oncogene in bladder cancer by activating the PI3K/Akt pathway and inhibiting PTEN.
25290267 Engrailed-2 (EN-2) is a developmentally regulated homeobox gene that is essential for Purkinje cell maturation and normal cerebellar development and patterning.
25003607 The mean EN2 levels in prostate cancer patients were 3.76-fold higher than those in non-prostate patients after prostate massage.
24675889 En2 identified as a new regulator of T-cell differentiation whose disruption induces a malignant T-cell fate in chronic myelogenous leukemia progression.
24532139 The exact role of EN2 expression in renal carcinoma carcinogenesis requires further investigation.
24520327 EN2 levels are increased in affected individuals with an A-C/G-T genotype, supporting EN2 as an autism spectrum disorder susceptibility gene.
24321989 Two patients with underdeveloped arcuate fasciculus had novel, nonsynonymous variants in MID1 and EN2 genes regulating axon guidance pathway.
23792811 Urinary EN2 may be useful as a non-invasive early biomarker for prostate cancer detection in genetically high-risk individuals
23434148 urinary EN2 has the potential to be a more sensitive and specific protein biomarker for non-muscle-invasive bladder cancer than currently available tests.
23423141 Normal EN-2 downregulation may not occur in some individuals with autism, such that the postnatal persistence of EN-2 overexpression may contribute to autism cerebellar abnormalities.
More...

AA Sequence

MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNFF      1 - 70
IDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQLLGSGSREPRQNPPCAPGAG     71 - 140
GPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQP    141 - 210
MLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQE    211 - 280
LSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE                     281 - 333
//

Text Mined References (46)

PMID Year Title
25812440 2015 Repression of engrailed 2 inhibits the proliferation and invasion of human bladder cancer in vitro and in vivo.
25290267 2014 Elevated 5-hydroxymethylcytosine in the Engrailed-2 (EN-2) promoter is associated with increased gene expression and decreased MeCP2 binding in autism cerebellum.
25003607 2015 Engrailed-2 protein as a potential urinary prostate cancer biomarker: a comparison study before and after digital rectal examination.
24675889 2014 Lineage-specific function of Engrailed-2 in the progression of chronic myelogenous leukemia to T-cell blast crisis.
24532139 2014 Engrailed-2 is down-regulated but also ectopically expressed in clear cell renal cell carcinoma.
24520327 2014 Autism associated gene, engrailed2, and flanking gene levels are altered in post-mortem cerebellum.
24321989 2014 Exome sequencing and diffusion tensor imaging in developmental disabilities.
23792811 2013 Role of Engrailed-2 (EN2) as a prostate cancer detection biomarker in genetically high risk men.
23434148 2013 Expression of Engrailed-2 (EN2) protein in bladder cancer and its potential utility as a urinary diagnostic biomarker.
23423141 2013 Complex epigenetic regulation of engrailed-2 (EN-2) homeobox gene in the autism cerebellum.
More...