Property Summary

NCBI Gene PubMed Count 534
Grant Count 540
R01 Count 183
Funding $115,670,508.36
PubMed Score 3000.51
PubTator Score 1864.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
intraductal papillary-mucinous neoplasm ... 2.000 0.048
lung cancer -2.700 0.000
ovarian cancer -1.900 0.000

Synonym

Accession P19544 A8K6S1 B3KSA5 Q15881 Q16256 Q16575 Q4VXV4 Q4VXV5 Q4VXV6 Q8IYZ5
Symbols GUD
AWT1
WAGR
WT33
NPHS4
WIT-2
EWS-WT1

Gene

WT1

PDB

3HPJ   3MYJ   4WUU   1LU6   1XF7   2G7T   2G7V   2G7W   2G7X   2JP9   2JPA   2PRT   4R2E   4R2P   4R2Q   4R2R   4R2S   5KL3   5KL4   5KL5   5KL7  

Gene RIF (479)

PMID Text
26997404 Letter: WT1 mutations were not present in steroid-resistant idiopathic nephrotic syndrome.
26721227 We present WT1 as a robust prognostic marker in high-grade serous ovarian carcinoma, which adds prognostic information to ER-alpha and should be kept in mind when WT1 is used as a biomarker in the context of WT1-targeting therapies.
26686990 The developmental expression regulation of WT1 protein in the human fetal heart has been presented.
26686553 Novel inguinal hernia susceptibility genes are identified as EFEMP1, WT1, EBF2 and ADAMTS6.
26655220 WT1 isoforms induce an array of miRNAs, which target the 3' UTR of EZH2 and other Polycomb-associated transcripts.
26644203 WT1 rs16754 polymorphism in AML could influence the standard chemotherapy effectiveness, specifically the variant allele (G) could be associated with increased overall survival. [meta-analysis]
26597595 A 4-gene expression score associated with high levels of Wilms Tumor-1 (WT1) expression is an adverse prognostic factor in acute myeloid leukaemia.
26573232 WT1 variant is associated with response to chemotherapy in breast cancer.
26531831 High WT1 gene expression is associated with Acute Myeloid Leukemia.
26514528 High WT1 expression levels are associated with Acute Leukemia.
More...

AA Sequence

MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPPPHS      1 - 70
FIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLES     71 - 140
QPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCT    141 - 210
GSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPI    211 - 280
LCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGE    281 - 350
KPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS    351 - 420
CQKKFARSDELVRHHNMHQRNMTKLQLAL                                             421 - 449
//

Text Mined References (542)

PMID Year Title
26997404 2016 WT1 mutations in steroid-resistant idiopathic nephrotic syndrome.
26721227 2016 Wilms tumor protein 1 (WT1)-- not only a diagnostic but also a prognostic marker in high-grade serous ovarian carcinoma.
26686990 2016 The roadmap of WT1 protein expression in the human fetal heart.
26686553 2015 A genome-wide association study identifies four novel susceptibility loci underlying inguinal hernia.
26655220 2016 Wilms Tumor Suppressor, WT1, Cooperates with MicroRNA-26a and MicroRNA-101 to Suppress Translation of the Polycomb Protein, EZH2, in Mesenchymal Stem Cells.
26644203 2016 A systematic review and meta-analysis of the impact of WT1 polymorphism rs16754 in the effectiveness of standard chemotherapy in patients with acute myeloid leukemia.
26597595 2016 A 4-gene expression score associated with high levels of Wilms Tumor-1 (WT1) expression is an adverse prognostic factor in acute myeloid leukaemia.
26573232 2016 A genome-wide association study identifies WT1 variant with better response to 5-fluorouracil, pirarubicin and cyclophosphamide neoadjuvant chemotherapy in breast cancer patients.
26531831 2016 WT1 Expression in Adult Acute Myeloid Leukemia: Assessing its Presence, Magnitude and Temporal Changes as Prognostic Factors.
26514528 2015 Assessment of Relationship between Wilms' Tumor Gene (WT1) Expression in Peripheral Blood of Acute Leukemia Patients and Serum IL-12 and C3 Levels.
More...