Property Summary

NCBI Gene PubMed Count 116
PubMed Score 297.22
PubTator Score 221.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
aldosterone-producing adenoma -1.700 3.1e-02
atypical teratoid / rhabdoid tumor -1.400 1.2e-05
COPD -1.100 1.7e-02
ductal carcinoma in situ -1.100 1.5e-03
ependymoma 1.200 6.3e-03
glioblastoma 1.300 2.4e-02
group 4 medulloblastoma -1.400 2.1e-04
invasive ductal carcinoma -1.200 5.9e-03
medulloblastoma, large-cell -2.500 1.2e-05
oligodendroglioma 1.500 1.4e-03
osteosarcoma 1.187 6.7e-03
ovarian cancer -2.000 2.2e-10
primary pancreatic ductal adenocarcinoma 1.241 3.8e-03
primitive neuroectodermal tumor -1.200 2.5e-03

Gene RIF (81)

AA Sequence

MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQ      1 - 70
PLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAA     71 - 140
PFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPK    141 - 210
LASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEML    211 - 280
SYLPGGTTGLQLPSTLPVSGNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDN    281 - 350
HNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN    351 - 420
RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQ    421 - 490
QPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAASDPLLSSVSPAVS    491 - 560
KASSRRSSFSMEEES                                                           561 - 575
//

Text Mined References (125)

PMID Year Title