Property Summary

NCBI Gene PubMed Count 95
Grant Count 85
R01 Count 44
Funding $4,242,425.03
PubMed Score 262.66
PubTator Score 221.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 1.200 0.006
oligodendroglioma 1.500 0.001
osteosarcoma 1.187 0.007
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma 1.300 0.024
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.200 0.003
primary pancreatic ductal adenocarcinoma 1.241 0.004
aldosterone-producing adenoma -1.700 0.031
COPD -1.100 0.017
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.200 0.006
ovarian cancer -2.000 0.000

Synonym

Accession P19532 A8MZL6 Q5JU74 Q92757 Q92758 Q99964
Symbols TFEA
RCCP2
RCCX1
bHLHe33

Gene

Gene RIF (61)

PMID Text
26813791 TFEB and TFE3 are novel components of the integrated stress response
26636097 CT features including diameter, boundary, attenuation, nature, and circular calcification of the tumor, combined with demographic information and symptoms, may be useful to differentiate Xp11.2 RCC from different subtypes of PRCC.
26516944 Studies indicate that alveolar soft part sarcoma showed a specific chromosomal alteration, der(17)t(X:17)(p11:q25), resulting in the fusion of the TFE3 transcription factor gene (Xp11) with alveolar soft part sarcoma critical region 1 (ASPSCR1) at 17q25.
26415891 validates the utility of TFE3 break-apart fluorescence in situ hybridization on formalin-fixed paraffin-embedded tissue sections for diagnosis and confirmation of Xp11.2 translocation RCCs and alveolar soft part sarcoma
26274027 PSF/SFPQ is a very common gene fusion partner in TFE3 rearrangement-associated perivascular epithelioid cell tumors (PEComas) and melanotic Xp11 translocation renal cancers.
26045774 TMED6-COG8 chimera might act as a novel diagnostic marker in TFE3 translocation renal cell carcinoma.
25955396 Renal cell carcinoma (RCC) associated with Xp11.2 translocation/TFE3 gene fusion (Xp11.2 RCC) was introduced as a genetically distinct entity into the World Health Organization classification of renal neoplasms in 2004.
25714283 The purpose of this study was to compare the MDCT features of renal cell carcinoma (RCC) associated with Xp11.2 translocation and TFE3 gene fusion (Xp11 RCC) and papillary RCC
25551622 We report a case of RCC with Xp11.2 translocation in a 17 year old boy who is a survivor of stage 4 neuroblastoma 13 years earlier.
25517951 Report TFE3 translocation-associated perivascular epithelioid cell neoplasms of the gynecological tract.
More...

AA Sequence

MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQ      1 - 70
PLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAA     71 - 140
PFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPK    141 - 210
LASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEML    211 - 280
SYLPGGTTGLQLPSTLPVSGNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDN    281 - 350
HNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN    351 - 420
RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQ    421 - 490
QPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAASDPLLSSVSPAVS    491 - 560
KASSRRSSFSMEEES                                                           561 - 575
//

Text Mined References (103)

PMID Year Title
26813791 2016 TFEB and TFE3 are novel components of the integrated stress response.
26636097 2015 Dynamic Contrast-Enhanced CT Characterization of Xp11.2 Translocation/TFE3 Gene Fusions versus Papillary Renal Cell Carcinomas.
26516944 2015 Alveolar Soft Part Sarcoma.
26415891 2015 Validation and utilization of a TFE3 break-apart FISH assay for Xp11.2 translocation renal cell carcinoma and alveolar soft part sarcoma.
26274027 2015 PSF/SFPQ is a very common gene fusion partner in TFE3 rearrangement-associated perivascular epithelioid cell tumors (PEComas) and melanotic Xp11 translocation renal cancers: clinicopathologic, immunohistochemical, and molecular characteristics suggesting classification as a distinct entity.
26045774 2015 TMED6-COG8 is a novel molecular marker of TFE3 translocation renal cell carcinoma.
25955396 Dynamic Computed Tomographic Features of Adult Renal Cell Carcinoma Associated With Xp11.2 Translocation/TFE3 Gene Fusions: Comparison With Clear Cell Renal Cell Carcinoma.
25714283 2015 MDCT findings of renal cell carcinoma associated with Xp11.2 translocation and TFE3 gene fusion and papillary renal cell carcinoma.
25551622 2015 Renal cell carcinoma with Xp 11.2 translocation as a second tumor in a long-term survivor of advanced neuroblastoma.
25517951 2015 TFE3 translocation-associated perivascular epithelioid cell neoplasm (PEComa) of the gynecologic tract: morphology, immunophenotype, differential diagnosis.
More...