Property Summary

NCBI Gene PubMed Count 55
Grant Count 5
Funding $260,551.3
PubMed Score 113.00
PubTator Score 224.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19526 O14505 O14506 O14507
Symbols H
HH
HSC

Gene

PANTHER Protein Class (2)

Gene RIF (32)

PMID Text
25761312 data confirm the hypothesis that the h2 allele is linked to Se(357, 716), and the concurrence of unique FUT1 and FUT2 mutations is geographically specific.
25297588 Data indicate that alpha -1,2 fucosyltransferase (FUT1) 682A> G and 547_552delAG mutations do not affect the transcript efficiency, although various mutations have different impact on the enzyme's activity.
25239830 FUT1 mediates c-Jun-induced cell proliferation in ovarian cancer cells.c-Jun transcriptionally modulates FUT1 expression in ovarian cancer cells.
25101798 Data indicate that single nucleotide polymorphism (SNPS) in the 3'-untranslated region of the fucosyltransferase 1 (FUT1) gene and intron of the syntaxin 1B (STX1B) gene were the top hits for Kawasaki disease (KD) susceptibility.
24665114 Fut1 plays an important role in regulating angiogenesis and ICAM-1 expression in inflammatory arthritis.
24593306 FUT1-specific fucosidase diminishes the activation of beta1 integrin.
24527852 Three new alleles in FUT1 and FUT2 genes were identified in the study. The allelic polymorphisms of FUT1 and FUT2 in Tibetans show a population-specific manner.
24467809 We show that fut1 in RA synovial fibroblasts is important in angiogenesis, leukocyte-synovial fibroblast adhesion, and synovial fibroblast proliferation
23533340 FUT1 mRNA expression in DLD-1 cells is transcriptionally regulated by Elk-1.
23063462 anti-H could accommodate grafts through triggering apoptosis and down-regulating Fut1 expression to reduce ABH antigens
More...

AA Sequence

MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSC      1 - 70
PQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTP     71 - 140
WRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDR    141 - 210
PRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVT    211 - 280
FAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWV    281 - 350
GINADLSPLWTLAKP                                                           351 - 365
//

Text Mined References (55)

PMID Year Title
25761312 2015 Genomic analysis of para-Bombay individuals in south-eastern China: the possibility of linkage and disequilibrium between FUT1 and FUT2.
25297588 2014 [Effect of ? -1,2 fucosyltransferase gene 682A> G and 547_552delAG mutations on the activity of fucosyltransferase].
25239830 2014 c-Jun transcriptionally regulates alpha 1, 2-fucosyltransferase 1 (FUT1) in ovarian cancer.
25101798 2014 High-density genotyping of immune loci in Kawasaki disease and IVIG treatment response in European-American case-parent trio study.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24665114 2015 A key role for Fut1-regulated angiogenesis and ICAM-1 expression in K/BxN arthritis.
24593306 2014 Calreticulin activates ?1 integrin via fucosylation by fucosyltransferase 1 in J82 human bladder cancer cells.
24527852 2014 Sequence analysis of the human fucosyltransferase 1 and 2 genes in Tibetan blood donors: identification of three novel alleles.
24467809 2014 Fucosyltransferase 1 mediates angiogenesis, cell adhesion and rheumatoid arthritis synovial tissue fibroblast proliferation.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
More...