Property Summary

NCBI Gene PubMed Count 62
PubMed Score 123.58
PubTator Score 224.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 7.9e-05
atypical teratoid / rhabdoid tumor -1.200 6.6e-05
ependymoma -1.200 4.6e-10
glioblastoma -1.200 6.9e-04
group 3 medulloblastoma -1.100 3.8e-02
intraductal papillary-mucinous adenoma (... -2.200 6.4e-04
intraductal papillary-mucinous carcinoma... -1.900 3.8e-03
lung adenocarcinoma -1.066 3.2e-09
lung cancer -1.500 3.8e-03
malignant mesothelioma 2.400 3.9e-07
osteosarcoma -5.673 1.1e-13
pancreatic cancer -1.400 2.1e-04
pediatric high grade glioma -1.100 3.8e-04
primary pancreatic ductal adenocarcinoma -1.511 1.8e-04
psoriasis -1.200 8.0e-04

 OMIM Phenotype (1)

Gene RIF (39)

AA Sequence

MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSC      1 - 70
PQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTP     71 - 140
WRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDR    141 - 210
PRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVT    211 - 280
FAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWV    281 - 350
GINADLSPLWTLAKP                                                           351 - 365
//

Text Mined References (62)

PMID Year Title