Property Summary

NCBI Gene PubMed Count 46
Grant Count 71
R01 Count 43
Funding $5,613,454.25
PubMed Score 173.64
PubTator Score 101.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.500 0.006
medulloblastoma, large-cell -1.100 0.030
hereditary spastic paraplegia 1.121 0.001
ovarian cancer 1.700 0.000
pituitary cancer -2.300 0.000

Synonym

Accession P19484 Q709B3 Q7Z6P9 Q9BRJ5 Q9UJD8
Symbols TCFEB
BHLHE35
ALPHATFEB

Gene

Gene RIF (35)

PMID Text
27299292 Review of the role of TFEB in lysosome biogenesis, transcriptional and post-transcriptional regulation of TFEB, and TFEB involvement in neurodegenerative disease as a dysregulated factor or as an agent used to promote cellular clearance.
26813791 TFEB and TFE3 are novel components of the integrated stress response
26596266 The autophagic response to polystyrene nanoparticles is mediated by TFEB and depends on surface charge.
26338325 This study demonstrated that transcription factor EB (TFEB) regulate the lysosome biogenesis in neurons of APP/PS1 mice, steady-state levels of APP were reduced, resulting in decreased interstitial fluid Abeta levels and attenuated amyloid deposits
26307679 TFEB1 overexpression is associated with drug resistance of ovarian cancer.
26264650 Silencing of TFEB with siRNAs in lung cancer cell lines resulted in reduced migration ability.
26240184 during mitophagy TFEB translocates to the nucleus and displays transcriptional activity in a PINK1- and Parkin-dependent manner.
26137861 TFEB was found to regulate MuRF1 expression in Angiotensin II-induced skeletal muscle atrophy.
26115100 a virus modulating TFEB localization and helps to explain how HIV modulates autophagy to promote its own replication and cell survival
26115100 HIV-1 Nef inhibits TFEB nuclear localization and autophagic flux; HIV-1 Nef is required for anti-autophagy during permissive (ongoing) HIV infection
More...

AA Sequence

MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVL      1 - 70
KVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAP     71 - 140
NSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSS    141 - 210
SCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKA    211 - 280
SVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQEL    281 - 350
PSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPG    351 - 420
HGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL                  421 - 476
//

Text Mined References (53)

PMID Year Title
27299292 2016 Transcription factor EB: from master coordinator of lysosomal pathways to candidate therapeutic target in degenerative storage diseases.
27184844 2016 An Evolutionarily Conserved PLC-PKD-TFEB Pathway for Host Defense.
26813791 2016 TFEB and TFE3 are novel components of the integrated stress response.
26596266 2015 The autophagic response to polystyrene nanoparticles is mediated by transcription factor EB and depends on surface charge.
26338325 2015 Neuronal-Targeted TFEB Accelerates Lysosomal Degradation of APP, Reducing A? Generation and Amyloid Plaque Pathogenesis.
26307679 2015 Transcriptome analysis indicates TFEB1 and YEATS4 as regulatory transcription factors for drug resistance of ovarian cancer.
26264650 2015 Increased expression of transcription factor EB (TFEB) is associated with autophagy, migratory phenotype and poor prognosis in non-small cell lung cancer.
26240184 2015 MiT/TFE transcription factors are activated during mitophagy downstream of Parkin and Atg5.
26137861 2015 Angiotensin II Induces Skeletal Muscle Atrophy by Activating TFEB-Mediated MuRF1 Expression.
26115100 2015 Human Immunodeficiency Virus Type 1 Nef Inhibits Autophagy through Transcription Factor EB Sequestration.
More...