Property Summary

NCBI Gene PubMed Count 67
PubMed Score 226.86
PubTator Score 101.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.500 6.2e-03
hereditary spastic paraplegia 1.121 9.0e-04
medulloblastoma, large-cell -1.100 3.0e-02
ovarian cancer 1.700 1.2e-05
pituitary cancer -2.300 2.5e-07

Protein-protein Interaction (8)

Gene RIF (58)

AA Sequence

MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVL      1 - 70
KVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAP     71 - 140
NSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSS    141 - 210
SCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKA    211 - 280
SVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQEL    281 - 350
PSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPG    351 - 420
HGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL                  421 - 476
//

Text Mined References (74)

PMID Year Title