Property Summary

NCBI Gene PubMed Count 103
PubMed Score 1099.35
PubTator Score 967.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 1.6e-08
cutaneous lupus erythematosus 2.100 4.5e-04
glioblastoma 1.100 1.5e-04
juvenile dermatomyositis 1.039 7.6e-12
lung cancer -2.400 1.5e-03
lung carcinoma -1.100 2.4e-14
Multiple Sclerosis 1.100 6.3e-03
osteosarcoma -1.910 1.0e-05

 IMPC Phenotype (1)

 GWAS Trait (1)

Gene RIF (76)

AA Sequence

MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA      1 - 70
NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ     71 - 140
VALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI    141 - 210
LGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK    211 - 280
MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG    281 - 350
KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF    351 - 420
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY                   421 - 475
//

Text Mined References (111)

PMID Year Title