Property Summary

NCBI Gene PubMed Count 96
Grant Count 117
R01 Count 53
Funding $11,699,000.98
PubMed Score 1050.83
PubTator Score 967.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 2.100 0.000
osteosarcoma -1.910 0.000
glioblastoma 1.100 0.000
juvenile dermatomyositis 1.039 0.000
lung cancer -2.400 0.001
Multiple Sclerosis 1.100 0.006
pilocytic astrocytoma 1.400 0.000
lung carcinoma -1.100 0.000

Synonym

Accession P19474 Q5XPV5 Q96RF8
Symbols SSA
RO52
SSA1
RNF81
Ro/SSA

Gene

PANTHER Protein Class (2)

PDB

2IWG  

Gene RIF (70)

PMID Text
26942676 TRIM21 plays an essential role in p62-regulated redox homeostasis and may be a viable target for treating pathological conditions resulting from oxidative damage.
26506431 TRIM21-induced exposure of the viral genome promotes sensing of DNA and RNA viruses by cGAS and RIG-I
26398169 The interaction of TRIM21 and LFG was analyzed by co-immunoprecipitation. To examine changes in regulatory processes, western blot analyses, real-time PCR, activity of apoptotic process and flow cytometric analyses were carried out.
26347139 TRIM20 and TRIM21 mediate precision autophagy, controlling the hub signaling machineries and key factors, inflammasome and type I interferon, directing cardinal innate immunity response systems in humans.
26342464 Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response
26315678 Anti-Ro52/TRIM21 antibodies are independently associated with the presence of interstitial lung disease and poor survival in systemic sclerosis.
26150489 This study elucidates a complex mechanism of step-wise ubiquitination and deubiquitination activities that allows contemporaneous innate immune signaling and neutralization by TRIM21.
26055142 we prove that TRIM21 is a potential tumor suppressor in hepatocellular carcinoma and its low expression indicates poor prognosis
25845745 Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the SS-A and SS-B autoantigens in salivary gland epithelial cells of Sjogren's syndrome patients.
25526666 Upregulation of SSA1 is associated with alcoholic and nonalcoholic steatohepatitis.
More...

AA Sequence

MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA      1 - 70
NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ     71 - 140
VALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI    141 - 210
LGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK    211 - 280
MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG    281 - 350
KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF    351 - 420
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY                   421 - 475
//

Text Mined References (104)

PMID Year Title
26942676 2016 TRIM21 Ubiquitylates SQSTM1/p62 and Suppresses Protein Sequestration to Regulate Redox Homeostasis.
26506431 2015 TRIM21 Promotes cGAS and RIG-I Sensing of Viral Genomes during Infection by Antibody-Opsonized Virus.
26398169 2015 TRIM21, a negative modulator of LFG in breast carcinoma MDA-MB-231 cells in vitro.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26342464 2015 Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response.
26315678 Monospecific anti-Ro52/TRIM21 antibodies in a tri-nation cohort of 1574 systemic sclerosis subjects: evidence of an association with interstitial lung disease and worse survival.
26150489 2015 Sequential ubiquitination and deubiquitination enzymes synchronize the dual sensor and effector functions of TRIM21.
26055142 2015 Downregulation of TRIM21 contributes to hepatocellular carcinoma carcinogenesis and indicates poor prognosis of cancers.
25845745 2015 Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the autoantigens Ro/Sjögren's syndrome-related antigen A (SSA) and La/SSB in salivary gland epithelial cells.
25526666 2015 Levels of metacaspase1 and chaperones related to protein quality control in alcoholic and nonalcoholic steatohepatitis.
More...