Property Summary

NCBI Gene PubMed Count 126
Grant Count 111
R01 Count 73
Funding $8,825,176.99
PubMed Score 209.44
PubTator Score 125.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.275 0.000
lung cancer 1.200 0.001
Pick disease -1.300 0.000
ovarian cancer 1.500 0.000

Synonym

Accession P19447 Q53QM0
Symbols XPB
BTF2
TTD2
GTF2H
RAD25
TFIIH

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IVW   4ERN  

Gene RIF (78)

PMID Text
25620205 Transcriptional differences found between various TFIIH subunit variants participate in the phenotypic variability observed among xeroderma pigmentosum, XP associated with Cockayne syndrome, and trichothiodystrophy individuals.
24609361 XPB and XPD enrichment at G4 motifs characterizes specific signaling pathways and regulatory pathways associated with specific cancers
23797950 findings suggest that benzene exposure may be associated with hypermethylation in ERCC3, and that genetic variants in EPHX1 may play an important role in epigenetic changes and hematotoxicity among benzene-exposed workers
23385459 The crystal structure of the C-terminal half of the XPB subunit of TFIIH (residues 494-782) is reported, containing XPB helicase domain (HD)2 and a C-terminal extension which shares structural similarity with RIG-I.
23382212 results identify the ARCH domain of XPD as a platform for the recruitment of CAK and as a molecular switch that might control TFIIH composition and play a role in conversion of TFIIH from a factor active in transcription to a factor involved in DNA repair
23083890 XPB and XPD helicases differentially regulate TFIIH compositional change during nucleotide excision repair.
22615732 reduction in ERCC3 by siRNA interference in human melanocytes in vitro reduced their tyrosinase production ability
22234153 Phenotype-specific adverse effects of XPD mutations on human prenatal development implicate impairment of TFIIH-mediated functions in placenta.
22174317 The interaction of Rev with ERCC3 is increased by the presence of RRE
22174317 The interaction of Rev with ERCC3 is increased by the presence of RRE
More...

AA Sequence

MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDD      1 - 70
HTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYL     71 - 140
RKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELI    141 - 210
TETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEEL    211 - 280
QKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVG    281 - 350
VTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS    351 - 420
WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYE    421 - 490
ANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIV    491 - 560
FADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHG    561 - 630
GSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEED    631 - 700
LAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPS    701 - 770
KHVHPLFKRFRK                                                              771 - 782
//

Text Mined References (134)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25620205 2015 TFIIH subunit alterations causing xeroderma pigmentosum and trichothiodystrophy specifically disturb several steps during transcription.
25492609 2015 Association of the winged helix motif of the TFIIE? subunit of TFIIE with either the TFIIE? subunit or TFIIB distinguishes its functions in transcription.
25482373 2015 Human mediator MED17 subunit plays essential roles in gene regulation by associating with the transcription and DNA repair machineries.
25416956 2014 A proteome-scale map of the human interactome network.
25069034 2014 Pharmacogenetics of the DNA repair pathways in advanced non-small cell lung cancer patients treated with platinum-based chemotherapy.
24609361 2014 G quadruplexes are genomewide targets of transcriptional helicases XPB and XPD.
24508195 2014 A small molecule screen identifies an inhibitor of DNA repair inducing the degradation of TFIIH and the chemosensitization of tumor cells to platinum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23797950 2013 Microsomal epoxide hydrolase (EPHX1) polymorphisms are associated with aberrant promoter methylation of ERCC3 and hematotoxicity in benzene-exposed workers.
More...