Property Summary

NCBI Gene PubMed Count 126
PubMed Score 209.44
PubTator Score 125.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.275 1.6e-05
lung cancer 1.200 9.2e-04
Pick disease -1.300 3.2e-05
ovarian cancer 1.500 2.4e-05

Gene RIF (64)

PMID Text
25620205 Transcriptional differences found between various TFIIH subunit variants participate in the phenotypic variability observed among xeroderma pigmentosum, XP associated with Cockayne syndrome, and trichothiodystrophy individuals.
24609361 XPB and XPD enrichment at G4 motifs characterizes specific signaling pathways and regulatory pathways associated with specific cancers
23797950 findings suggest that benzene exposure may be associated with hypermethylation in ERCC3, and that genetic variants in EPHX1 may play an important role in epigenetic changes and hematotoxicity among benzene-exposed workers
23385459 The crystal structure of the C-terminal half of the XPB subunit of TFIIH (residues 494-782) is reported, containing XPB helicase domain (HD)2 and a C-terminal extension which shares structural similarity with RIG-I.
23382212 results identify the ARCH domain of XPD as a platform for the recruitment of CAK and as a molecular switch that might control TFIIH composition and play a role in conversion of TFIIH from a factor active in transcription to a factor involved in DNA repair
23083890 XPB and XPD helicases differentially regulate TFIIH compositional change during nucleotide excision repair.
22615732 reduction in ERCC3 by siRNA interference in human melanocytes in vitro reduced their tyrosinase production ability
22234153 Phenotype-specific adverse effects of XPD mutations on human prenatal development implicate impairment of TFIIH-mediated functions in placenta.
22174317 The interaction of Rev with ERCC3 is increased by the presence of RRE
21971700 high expression of ERCC1, XPB and ILF3 was observed in human epithelial ovarian cancer
21672525 These results indicated that persistent HBV infection might trigger NER impairment in part through upregulation of miR-192, which suppressed the levels of ERCC3 and ERCC4.
21167544 These results suggest that TFIIH mediated cDNA degradation is a nuclear host defense against retroviral infection.
21157430 The phosphorylation of the androgen receptor by TFIIH directs the ubiquitin/proteasome process.
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20543986 results demonstrated that a) XP-G/CS mutations affect the disassembly state of TFIIH resulting in the dissociation of CAK, but not XPD from core TFIIH
20530579 The C1D gene has been identified as one of the major genes whose expression is significantly upregulated by restoring XPB function.
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20208140 TFIIH core subunit p89, but not other subunits of TFIIH, associates with the centrosomes and the adjacent parts of the mitotic spindle during mitosis.
20004634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19840190 Results show that a deficiency in functional XPB paradoxically renders cells more sensitive to the genotoxic effects of oxidative stress while reducing the cytotoxic effects.
19773279 Single Nucleotide Polimorphisms in VEGF and ERCC3 were associated with alterations in White Blood Cells and WBC subtype counts in workers exposed to benzene, even at relatively low levels of exposure below 1 ppm.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19338310 Multiple proteins both known and unknown to interact with RAD52 were identified by the "dual-tagging" proteomic method.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18187620 The interaction of Rev with ERCC3 is increased by the presence of RRE
18187620 Knockdown of excision repair cross-complementing rodent repair deficiency, complementation group 3 (ERCC3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17466626 mechanism in which the helicase activity of XPB is not used for the opening and repair of damaged DNA, which is instead only driven by its ATPase activity, in combination with the helicase activity of XPD
16914395 XPB could inhibit the proliferation of hepatoma cells and had a positive effect on the expression of p53 and p21(waf1/cip1) but a negative effect on c-myc.
16835333 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16835333 Single Nucleotide Polymorphism in the ERCC3 is associated with lung cancer
15549133 data support an additional role for XPB in promoting the incision of the damaged DNA fragment and reveal a point of nucleotide excision repair regulation on TFIIH without interference in its transcription activity
15375507 Reduced expression of ERCC3 was correlated with esophageal cancer progression
15220921 identification of a new, evolutionarily conserved, core TFIIH subunit is essential for our understanding of TFIIH function in transcription, DNA repair and human disease
14614013 High XRB mRNA levels is associated with Clear cell tumors of epithelial ovarian cancer
14569024 The interaction of Rev with ERCC3 is increased by the presence of RRE
12865926 Observational study of gene-disease association. (HuGE Navigator)
12820975 TFIIH from trichothiodystrophy patients, but not from xeroderma pigmentosum patients, exhibit a significant in vitro basal transcription defect in addition to a reduced intercellular concentration.
12393803 Reduced level of the repair/transcription factor TFIIH in trichothiodystrophy.
12080057 p52 mediates function within the transcription/repair factor TFIIH.
11572868 The interaction of Rev with ERCC3 is increased by the presence of RRE
10866664 The interaction of Rev with ERCC3 is increased by the presence of RRE
10438593 The interaction of Rev with ERCC3 is increased by the presence of RRE
10082552 The interaction of Rev with ERCC3 is increased by the presence of RRE
10066804 The interaction of Rev with ERCC3 is increased by the presence of RRE
9765201 The interaction of Rev with ERCC3 is increased by the presence of RRE
9651670 The interaction of Rev with ERCC3 is increased by the presence of RRE
9570510 The interaction of Rev with ERCC3 is increased by the presence of RRE
9334327 The interaction of Rev with ERCC3 is increased by the presence of RRE
9311822 The interaction of Rev with ERCC3 is increased by the presence of RRE
9184228 The interaction of Rev with ERCC3 is increased by the presence of RRE
9121429 The interaction of Rev with ERCC3 is increased by the presence of RRE
9054383 The interaction of Rev with ERCC3 is increased by the presence of RRE
8934526 The interaction of Rev with ERCC3 is increased by the presence of RRE
8849451 The interaction of Rev with ERCC3 is increased by the presence of RRE
8628270 The interaction of Rev with ERCC3 is increased by the presence of RRE

AA Sequence

MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDD      1 - 70
HTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYL     71 - 140
RKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELI    141 - 210
TETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEEL    211 - 280
QKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVG    281 - 350
VTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS    351 - 420
WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYE    421 - 490
ANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIV    491 - 560
FADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHG    561 - 630
GSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEED    631 - 700
LAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPS    701 - 770
KHVHPLFKRFRK                                                              771 - 782
//

Text Mined References (134)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25620205 2015 TFIIH subunit alterations causing xeroderma pigmentosum and trichothiodystrophy specifically disturb several steps during transcription.
25492609 2015 Association of the winged helix motif of the TFIIE? subunit of TFIIE with either the TFIIE? subunit or TFIIB distinguishes its functions in transcription.
25482373 2015 Human mediator MED17 subunit plays essential roles in gene regulation by associating with the transcription and DNA repair machineries.
25416956 2014 A proteome-scale map of the human interactome network.
25069034 2014 Pharmacogenetics of the DNA repair pathways in advanced non-small cell lung cancer patients treated with platinum-based chemotherapy.
24609361 2014 G quadruplexes are genomewide targets of transcriptional helicases XPB and XPD.
24508195 2014 A small molecule screen identifies an inhibitor of DNA repair inducing the degradation of TFIIH and the chemosensitization of tumor cells to platinum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23797950 2013 Microsomal epoxide hydrolase (EPHX1) polymorphisms are associated with aberrant promoter methylation of ERCC3 and hematotoxicity in benzene-exposed workers.
23706737 2013 Global regulation of promoter melting in naive lymphocytes.
23562818 2013 Mutations in TFIIH causing trichothiodystrophy are responsible for defects in ribosomal RNA production and processing.
23385459 2013 Structure of the C-terminal half of human XPB helicase and the impact of the disease-causing mutation XP11BE.
23382212 2013 ARCH domain of XPD, an anchoring platform for CAK that conditions TFIIH DNA repair and transcription activities.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23083890 2012 Lack of CAK complex accumulation at DNA damage sites in XP-B and XP-B/CS fibroblasts reveals differential regulation of CAK anchoring to core TFIIH by XPB and XPD helicases during nucleotide excision repair.
22615732 2012 Deficiency in nucleotide excision repair family gene activity, especially ERCC3, is associated with non-pigmented hair fiber growth.
22234153 2012 Phenotype-specific adverse effects of XPD mutations on human prenatal development implicate impairment of TFIIH-mediated functions in placenta.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21971700 2012 Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer.
21672525 2011 MiR-192 inhibits nucleotide excision repair by targeting ERCC3 and ERCC4 in HepG2.2.15 cells.
21167544 2011 XPB mediated retroviral cDNA degradation coincides with entry to the nucleus.
21157430 2011 The phosphorylation of the androgen receptor by TFIIH directs the ubiquitin/proteasome process.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20543986 2010 Dissociation of CAK from core TFIIH reveals a functional link between XP-G/CS and the TFIIH disassembly state.
20530579 2010 XPB induces C1D expression to counteract UV-induced apoptosis.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20208140 2010 The TFIIH subunit p89 (XPB) localizes to the centrosome during mitosis.
20004634 2010 Breast cancer risk and common single nucleotide polymorphisms in homologous recombination DNA repair pathway genes XRCC2, XRCC3, NBS1 and RAD51.
19840190 2010 Telomere attrition and genomic instability in xeroderma pigmentosum type-b deficient fibroblasts under oxidative stress.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19338310 2009 Streamline proteomic approach for characterizing protein-protein interaction network in a RAD52 protein complex.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19106100 2009 MCAF1/AM is involved in Sp1-mediated maintenance of cancer-associated telomerase activity.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
17614221 2007 Genetic susceptibility of newborn daughters to oxidative stress.
17509950 2007 Influence of XPB helicase on recruitment and redistribution of nucleotide excision repair proteins at sites of UV-induced DNA damage.
17466626 2007 Distinct roles for the XPB/p52 and XPD/p44 subcomplexes of TFIIH in damaged DNA opening during nucleotide excision repair.
17438371 2007 Detection and identification of transcription factors as interaction partners of alien in vivo.
17088560 2006 DNA nucleotide excision repair-dependent signaling to checkpoint activation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16947863 2006 Phenotypic heterogeneity in the XPB DNA helicase gene (ERCC3): xeroderma pigmentosum without and with Cockayne syndrome.
16914395 2006 The role of XPB in cell apoptosis and viability and its relationship with p53, p21(waf1/cip1) and c-myc in hepatoma cells.
16835333 2006 Polymorphisms in the two helicases ERCC2/XPD and ERCC3/XPB of the transcription factor IIH complex and risk of lung cancer: a case-control analysis in a Chinese population.
16710452 2006 Effect of DNA repair protein Rad18 on viral infection.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15549133 2004 Phosphorylation of XPB helicase regulates TFIIH nucleotide excision repair activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375507 2004 Excision repair cross complementing 3 expression is involved in patient prognosis and tumor progression in esophageal cancer.
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614013 2003 Clear cell tumors have higher mRNA levels of ERCC1 and XPB than other histological types of epithelial ovarian cancer.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12865926 2003 Lack of involvement of nucleotide excision repair gene polymorphisms in colorectal cancer.
12820975 2003 Basal transcription defect discriminates between xeroderma pigmentosum and trichothiodystrophy in XPD patients.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393803 2002 Reduced level of the repair/transcription factor TFIIH in trichothiodystrophy.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
12372413 2002 Association of human RAD52 protein with transcription factors.
12080057 2002 p52 Mediates XPB function within the transcription/repair factor TFIIH.
11572868 2001 TFIIH inhibits CDK9 phosphorylation during human immunodeficiency virus type 1 transcription.
11335038 2001 Trichothiodystrophy, a transcription syndrome.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11278765 2001 Transcriptional regulation of the TFIIH transcription repair components XPB and XPD by the hepatitis B virus x protein in liver cells and transgenic liver tissue.
11239393 2001 Defective interplay of activators and repressors with TFIH in xeroderma pigmentosum.
10882074 2000 The FBP interacting repressor targets TFIIH to inhibit activated transcription.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10862089 2000 Identification of four single nucleotide polymorphisms in DNA repair genes: XPA and XPB (ERCC3) in Polish population.
10827951 2000 Mechanism of ATP-dependent promoter melting by transcription factor IIH.
10801852 2000 Distinct regions of MAT1 regulate cdk7 kinase and TFIIH transcription activities.
10734143 2000 The xeroderma pigmentosum group C protein complex XPC-HR23B plays an important role in the recruitment of transcription factor IIH to damaged DNA.
10583946 1999 Quality control by DNA repair.
10447254 1999 A summary of mutations in the UV-sensitive disorders: xeroderma pigmentosum, Cockayne syndrome, and trichothiodystrophy.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10403766 1999 BCR binds to the xeroderma pigmentosum group B protein.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10082552 1999 Tat activates human immunodeficiency virus type 1 transcriptional elongation independent of TFIIH kinase.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
10024882 1999 Reconstitution of the transcription factor TFIIH: assignment of functions for the three enzymatic subunits, XPB, XPD, and cdk7.
9874796 1999 The BCR-ABL oncoprotein potentially interacts with the xeroderma pigmentosum group B protein.
9852112 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9334327 1997 The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II.
9311822 1997 A human primary T-lymphocyte-derived human immunodeficiency virus type 1 Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity.
9184228 1997 Purification of a Tat-associated kinase reveals a TFIIH complex that modulates HIV-1 transcription.
9173976 1997 The XPB subunit of repair/transcription factor TFIIH directly interacts with SUG1, a subunit of the 26S proteasome and putative transcription factor.
9130708 1997 Substrate specificity of the cdk-activating kinase (CAK) is altered upon association with TFIIH.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9118947 1997 Cloning and characterization of p52, the fifth subunit of the core of the transcription/DNA repair factor TFIIH.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
9012405 1997 A mutation in the XPB/ERCC3 DNA repair transcription gene, associated with trichothiodystrophy.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8876669 1996 Comparative analyses of relative ERCC3 and ERCC6 mRNA levels in gliomas and adjacent non-neoplastic brain.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8692842 1996 Human cyclin-dependent kinase-activating kinase exists in three distinct complexes.
8692841 1996 Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH.
8675009 1996 The XPB and XPD DNA helicases are components of the p53-mediated apoptosis pathway.
8663148 1996 A 3' --> 5' XPB helicase defect in repair/transcription factor TFIIH of xeroderma pigmentosum group B affects both DNA repair and transcription.
8652557 1996 Interactions involving the human RNA polymerase II transcription/nucleotide excision repair complex TFIIH, the nucleotide excision repair protein XPG, and Cockayne syndrome group B (CSB) protein.
8628270 1996 Three functional classes of transcriptional activation domain.
8408834 1993 Xeroderma pigmentosum-Cockayne syndrome complex in two patients: absence of skin tumors despite severe deficiency of DNA excision repair.
8304337 1994 Clinical heterogeneity within xeroderma pigmentosum associated with mutations in the DNA repair and transcription gene ERCC3.
8202161 1994 RAD25 is a DNA helicase required for DNA repair and RNA polymerase II transcription.
8194528 1994 The ERCC2/DNA repair protein is associated with the class II BTF2/TFIIH transcription factor.
8157004 1994 Correction of xeroderma pigmentosum repair defect by basal transcription factor BTF2 (TFIIH).
8152490 1994 Dual role of TFIIH in DNA excision repair and in transcription by RNA polymerase II.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7926747 1994 Transcription factor IIE binds preferentially to RNA polymerase IIa and recruits TFIIH: a model for promoter clearance.
7724549 1995 The 62- and 80-kDa subunits of transcription factor IIH mediate the interaction with Epstein-Barr virus nuclear protein 2.
7663514 1995 p53 modulation of TFIIH-associated nucleotide excision repair activity.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
2167179 1990 A presumed DNA helicase encoded by ERCC-3 is involved in the human repair disorders xeroderma pigmentosum and Cockayne's syndrome.
2111438 1990 Molecular cloning and biological characterization of the human excision repair gene ERCC-3.
1956789 1991 Structure and expression of the human XPBC/ERCC-3 gene involved in DNA repair disorders xeroderma pigmentosum and Cockayne's syndrome.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.
1916809 1991 Localization of the xeroderma pigmentosum group B-correcting gene ERCC3 to human chromosome 2q21.
1741247 1992 Molecular and functional analysis of the XPBC/ERCC-3 promoter: transcription activity is dependent on the integrity of an Sp1-binding site.