Property Summary

NCBI Gene PubMed Count 161
Grant Count 131
R01 Count 81
Funding $20,597,486.68
PubMed Score 1697.41
PubTator Score 467.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19440 Q08247 Q14404 Q8TBS1 Q9UMK1 GGT 1
Symbols GGT
GTG
CD224
GGT 1
D22S672
D22S732

Gene

PANTHER Protein Class (2)

PDB

4GDX   4GG2   4Z9O   4ZBK   4ZC6   4ZCG  

Gene RIF (109)

PMID Text
26863311 gamma-Glutamyltransferase is an independent risk factor for breast cancer beyond the consumption of alcohol and other life style risk factors
26463174 macrophages characterized by a pro-inflammatory phenotype may contribute to intra-plaque accumulation of b-GGT, with role in the progression of atherosclerosis
26414209 Elevated serum GGT levels are independently associated with coronary artery calcification progression
26252286 High serum GGT levels were an independent risk factor for all-cause mortality in peritoneal dialysis patients.
26175398 serum GGT and LDH together with higher BCLC staging should be potential predictive factors for HCC overall survival.
26152752 There were similar hazards for all-cause and cancer mortality and attenuated hazards for cardiovascular mortality for people in the highest GGT quartile, adjusting for fatty liver assessed by either ultrasound or fatty liver index.
26013825 report crystal structures that show conformational changes within the active site as the enzyme progresses from the free enzyme to inhibitor-bound tetrahedral transition states and to a glutamate-bound structure prior to release of final reaction product
25952030 Interactive effects of GGT1 G allele and low HDL-cholesterol level on diabetic angiopathy is identified.
25913781 Elevated serum GGT activity was independently associated with sarcopenia and sarcopenic obesity in community-dwelling older adults.
25500578 Serum GGT level is associated with urinary albumin excretion in middle-aged and elderly Chinese.
More...

AA Sequence

MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIA      1 - 70
ALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRG     71 - 140
YELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTL    141 - 210
PQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAP    211 - 280
LSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFF    281 - 350
AAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNE    351 - 420
MDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLW    421 - 490
FGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDS    491 - 560
RKGGEPAGY                                                                 561 - 569
//

Text Mined References (162)

PMID Year Title
26863311 2016 ?-Glutamyltransferase and Breast Cancer Risk Beyond Alcohol Consumption and Other Life Style Factors - A Pooled Cohort Analysis.
26463174 2015 Monocytes/macrophages activation contributes to b-gamma-glutamyltransferase accumulation inside atherosclerotic plaques.
26414209 2015 Association between serum gamma-glutamyltransferase and the progression of coronary artery calcification.
26252286 2015 Serum Gamma-Glutamyltransferase Levels Predict Mortality in Patients With Peritoneal Dialysis.
26175398 2015 Elevation of serum GGT and LDH levels, together with higher BCLC staging are associated with poor overall survival from hepatocellular carcinoma: a retrospective analysis.
26152752 2015 ?-Glutamyl Transferase Is Associated with Mortality Outcomes Independently of Fatty Liver.
26013825 2015 Human ?-Glutamyl Transpeptidase 1: STRUCTURES OF THE FREE ENZYME, INHIBITOR-BOUND TETRAHEDRAL TRANSITION STATES, AND GLUTAMATE-BOUND ENZYME REVEAL NOVEL MOVEMENT WITHIN THE ACTIVE SITE DURING CATALYSIS.
25952030 2015 Interactive effects of a common ?-glutamyltransferase 1 variant and low high-density lipoprotein-cholesterol on diabetic macro- and micro-angiopathy.
25913781 2015 Gamma-glutamyl transferase is associated with sarcopenia and sarcopenic obesity in community-dwelling older adults: results from the Fifth Korea National Health and Nutrition Examination Survey, 2010-2011.
25500578 2014 Serum gamma - glutamyltransferase is associated with albuminuria: a population-based study.
More...