Property Summary

Ligand Count 18
NCBI Gene PubMed Count 570
PubMed Score 1897.33
PubTator Score 1231.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 4.044 2.0
Primary biliary cirrhosis 51 0.0 3.0
Disease Target Count Z-score Confidence
Autosomal dominant familial periodic fever 3 0.0 5.0

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.500 1.0e-02
Astrocytoma, Pilocytic 1.500 1.7e-08
ependymoma 1.100 8.8e-06
glioblastoma 1.600 6.4e-03
group 4 medulloblastoma -1.300 4.6e-04
hepatocellular carcinoma 1.200 2.2e-04
lung cancer -1.600 7.2e-05
lung carcinoma -1.200 8.4e-17
medulloblastoma, large-cell -1.300 7.0e-04
non diabetic and post-ischemic heart fai... -1.100 1.4e-03
ovarian cancer -1.500 2.8e-07
pancreatic cancer 1.300 1.3e-03
pancreatic carcinoma 1.300 1.3e-03
pituitary cancer -1.400 8.4e-04
primary pancreatic ductal adenocarcinoma 1.149 1.7e-02
subependymal giant cell astrocytoma 1.753 5.0e-03

 CSPA Cell Line (2)

Gene RIF (503)

AA Sequence

MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYN      1 - 70
DCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENL     71 - 140
FQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT    141 - 210
TVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFT    211 - 280
PTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQS    281 - 350
LDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL    351 - 420
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR                                       421 - 455
//

Text Mined References (572)

PMID Year Title