Property Summary

NCBI Gene PubMed Count 535
Grant Count 1,223
R01 Count 853
Funding $89,541,861.51
PubMed Score 1806.18
PubTator Score 1231.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession P19438 A8K4X3 B2RDE4 B3KPQ1 B4DQB7 B4E309 B5M0B5 D3DUR1 Q9UCA4
Symbols FPF
p55
p60
TBP1
TNF-R
TNFAR
TNFR1
p55-R
CD120a
TNFR55
TNFR60
TNF-R-I
TNF-R55

Gene

PDB

1TNR   1EXT   1FT4   1ICH   1NCF  

Gene RIF (469)

PMID Text
26928194 Higher circulating sTNFR1 and sTNFR2 are associated with diabetic kidney disease, and predicts incident cardiovascular disease and mortality independently of microalbuminuria and kidney function in type 2 diabetics.
26888535 TNFR1 (and IL-6) concentrations predict risk of recurrent vascular events in recent lacunar stroke patients.
26813918 The serum levels of TNF-alpha and sTNFR I showed a significant decreasing trend after treatment in cutaneous leishmaniasis.
26777482 overexpression of sTNF-alphaR-Fc in pig islets prolongs islet xenograft survival
26755728 Following TNF-converting enzyme-mediated ectodomain shedding of TNF type I receptor (TNFR1), the membrane-bound TNFR1 C-terminal fragment is subsequently cleaved by gamma-secretase to generate a cytosolic TNFR1 intracellular domain.
26616867 data suggest that the R92Q mutation gives rise to a stronger interaction between the receptor and its ligand, which results in the potentiation of TNF-mediated pathways
26574625 Atorvastatin reduced soluble TNFR1/2 receptors in systemic lupus erythematosus.
26499922 These results suggest that CR1 induces apoptosis by activating the caspase pathway via binding to TNFR1.
26475675 The release of extracellular vesicles was triggered by TNFA from BEAS-2b cells.TNFA-triggered extracellular vesicles contained TNFR1 and TRADD.
26270730 Data show that NCI-H716 cells were immunostained for tumor necrosis factor receptor TNFR1, and TNFalpha treatment enhances glucagon-like peptide-1 (GLP-1) secretion.
More...

AA Sequence

MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYN      1 - 70
DCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENL     71 - 140
FQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT    141 - 210
TVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFT    211 - 280
PTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQS    281 - 350
LDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL    351 - 420
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR                                       421 - 455
//

Text Mined References (537)

PMID Year Title
26928194 2016 Association of soluble tumor necrosis factor receptors 1 and 2 with nephropathy, cardiovascular events, and total mortality in type 2 diabetes.
26888535 2016 Inflammatory Markers and Outcomes After Lacunar Stroke: Levels of Inflammatory Markers in Treatment of Stroke Study.
26813918 2016 Tumour Necrosis Factor-alpha (TNF-?) and its soluble receptor type 1 (sTNFR I) in human active and healed leishmaniases.
26777482 2016 Beneficial effects of the transgenic expression of human sTNF-?R-Fc and HO-1 on pig-to-mouse islet xenograft survival.
26755728 2016 ?-Secretase Activity Is Required for Regulated Intramembrane Proteolysis of Tumor Necrosis Factor (TNF) Receptor 1 and TNF-mediated Pro-apoptotic Signaling.
26616867 2015 Molecular dynamics and intracellular signaling of the TNF-R1 with the R92Q mutation.
26574625 Atorvastatin reduced soluble receptors of TNF-alpha in systemic lupus erythematosus.
26499922 2015 Inhibitory effect of carbonyl reductase 1 on ovarian cancer growth via tumor necrosis factor receptor signaling.
26475675 2015 TNF? triggers release of extracellular vesicles containing TNFR1 and TRADD, which can modulate TNF? responses of the parental cells.
26270730 2015 Chronic Exposure to TNF? Impairs Secretion of Glucagon-Like Peptide-1.
More...