Property Summary

NCBI Gene PubMed Count 273
Grant Count 229
R01 Count 148
Funding $32,544,805.87
PubMed Score 3223.95
PubTator Score 1640.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.100 0.021
facioscapulohumeral dystrophy 1.800 0.030

Synonym

Accession P19429
Symbols CMH7
RCM1
cTnI
CMD2A
TNNC1
CMD1FF

Gene

PDB

1J1D   1J1E   1LXF   1MXL   1OZS   2KGB   2KRD   2L1R   2MZP   2N7L   4Y99  

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
493008 screening 801 / 0 / 334660 Fluorescence-based biochemical primary high throughput screening assay to identify activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
493018 summary 0 / 0 / 0 Summary of the probe development efforts to identify activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
493244 screening 390 / 0 / 335070 Fluorescence-based biochemical primary high throughput screening assay to identify inhibitors of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504337 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504383 screening 1166 / 0 / 1301 Fluorescence-based biochemical high throughput confirmation assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504635 screening 30 / 0 / 328 Fluorescence-based biochemical high throughput confirmation assay for inhibitors of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504698 confirmatory 76 / 0 / 168 Fluorescence-based biochemical high throughput dose response assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
504742 confirmatory 14 / 0 / 18 Fluorescence-based biochemical high throughput dose response assay for inhibitors of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF)
602231 other 0 / 0 / 4 Assay provider mechanism-of-action assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF): biochemical assay to identify activators of the Ca2+-sensitivity of cardiac muscle contraction/tension
602232 other 2 / 0 / 14 Assay provider mechanism-of-action assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF): absorbance-based biochemical assay to identify sensitizers of the Ca2+ sensitivity of cardiac myofibrillar ATPase
More...

Gene RIF (235)

PMID Text
26553696 Compromised interactions of K206I with actin and hcTnC may lead to impaired relaxation and HCM.
26553374 The incidence of adverse cardiovascular events was significantly higher in patients with troponin elevation after carotid endarterectomy, which was mainly attributable to silent non-ST segment elevation MIs that occurred in the early post-operative phase.
26506446 These findings showed that a double heterozygous mutation in the TNNI3 gene is involved in the pathogenesis of hypertrophic cardiomyopathy via haploinsufficiency.
26476506 hsTnI at the time of presentation followed by early advanced coronary CTA assessment improves the risk stratification and diagnostic accuracy for acute coronary syndromes.
26185217 Using an overall 99th percentile for cTnI does not appear to increase the prevalence of myocardial injury or lead to further hospital admissions from the emergency department.
26169204 Four novel missense variants were identified in TNNI3.
26111167 Troponin C (TnC) and the N-terminal helix of Troponin I (TnI N-helix), which occurs in vivo during muscle contraction.
26049777 In this pilot study, the addition of CACS to hsTnI improves the identification of low-risk subjects in whom CTA might be avoided.
25940119 mutations underlying restrictive cardiomyopathy all marked by right-sided cardiac manifestations in South African patients
25916738 Letter/Case Report: acute decompensated heart failure with troponin I elevation in hereditary hemochromatosis.
More...

AA Sequence

MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRG      1 - 70
EKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFK     71 - 140
RPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES    141 - 210
//

Text Mined References (275)

PMID Year Title
26553696 2015 Green Tea Catechin Normalizes the Enhanced Ca2+ Sensitivity of Myofilaments Regulated by a Hypertrophic Cardiomyopathy-Associated Mutation in Human Cardiac Troponin I (K206I).
26553374 2016 Clinical Relevance of Cardiac Troponin Assessment in Patients Undergoing Carotid Endarterectomy.
26506446 2016 A Double Heterozygous Mutation of TNNI3 Causes Hypertrophic Cardiomyopathy in a Han Chinese Family.
26476506 2015 hs-Troponin I Followed by CT Angiography Improves Acute Coronary Syndrome Risk Stratification Accuracy and Work-Up in Acute Chest Pain Patients: Results From ROMICAT II Trial.
26185217 2015 Hospital Admission and Myocardial Injury Prevalence after the Clinical Introduction of a High-Sensitivity Cardiac Troponin I Assay.
26169204 2016 Identification of rare variants in TNNI3 with atrial fibrillation in a Chinese GeneID population.
26111167 2015 Coarse-Grained Modeling of Peptide Docking Associated with Large Conformation Transitions of the Binding Protein: Troponin I Fragment-Troponin C System.
26049777 2015 Low high-sensitivity troponin I and zero coronary artery calcium score identifies coronary CT angiography candidates in whom further testing could be avoided.
25940119 Diagnostic disparity and identification of two TNNI3 gene mutations, one novel and one arising de novo, in South African patients with restrictive cardiomyopathy and focal ventricular hypertrophy.
25916738 2015 A patient with a rare cause of elevated troponin I.
More...