Property Summary

NCBI Gene PubMed Count 142
PubMed Score 3.02
PubTator Score 136.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.8e-05
astrocytoma 1146 1.1e-03
subependymal giant cell astrocytoma 2287 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hypervitaminosis A 13 4.001 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.200 1.1e-03
osteosarcoma 1.335 2.8e-05
subependymal giant cell astrocytoma -1.278 1.1e-02

 IMPC Phenotype (1)

Gene RIF (88)

AA Sequence

MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDK      1 - 70
NIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMA     71 - 140
GPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEA    141 - 210
EEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQE    211 - 280
GVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGP    281 - 350
ALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV    351 - 420
LSPGPQKP                                                                  421 - 428
//

Text Mined References (148)

PMID Year Title