Property Summary

NCBI Gene PubMed Count 135
Grant Count 150
R01 Count 121
Funding $10,533,348.01
PubMed Score 2.39
PubTator Score 136.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.335 0.000
astrocytoma -1.200 0.001
subependymal giant cell astrocytoma -1.278 0.011

Synonym

Accession P19419 B2R7H4 O75606 O95058 Q969X8 Q9UJM4
Symbols

Gene

PANTHER Protein Class (1)

PDB

1DUX  

Gene RIF (81)

PMID Text
26864615 ELK1 is likely to be activated in prostate cancer cells and promote tumor progression. Furthermore, silodosin that inactivates ELK1 in prostate cancer cells not only inhibits their growth but also enhances the cytotoxic activity of gemcitabine.
26861876 These data reveal a novel role for Elk1 regulating ITGB6 expression and highlight how dysregulation of Elk1 can contribute to human disease.
26667302 Negative feedback regulation of AXL by miR-34a modulates apoptosis in lung cancer cells by activating the transcription factor ELK1 via the JNK signaling pathway.
26617947 Downregulated expression of transcriptional activator ELK-1 may play an important role in the pathogenesis of atrial fibrillation.
26342199 results suggest that ELK1 plays an important role in bladder tumorigenesis and cancer progression.
26010542 These findings suggest that PKCalpha expression in HCC could be stimulated by the formation of MZF-1/Elk-1 complex, which directly binds to the PKCalpha promoter.
25537503 Data show that afatinib reduced Elk-1 transcription factor binding to the CIP2A protein promoter and suppressed CIP2A transcription.
25066273 interleukin-1beta (IL-1beta)-induced IER3 expression is mediated by the ERK1/2 target, transcription factor Elk-1.
24130510 our data suggest that preferential binding of activated Elk-1 to the IL10 rs3122605-G allele upregulates IL10 expression and confers increased risk for SLE in European Americans.
24121020 TNF-alpha modulation of intestinal epithelial tight junction barrier is regulated by ERK1/2 activation of Elk-1.
More...

AA Sequence

MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDK      1 - 70
NIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMA     71 - 140
GPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEA    141 - 210
EEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQE    211 - 280
GVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGP    281 - 350
ALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV    351 - 420
LSPGPQKP                                                                  421 - 428
//

Text Mined References (141)

PMID Year Title
26864615 2016 Silodosin inhibits prostate cancer cell growth via ELK1 inactivation and enhances the cytotoxic activity of gemcitabine.
26861876 2016 Reduced Ets Domain-containing Protein Elk1 Promotes Pulmonary Fibrosis via Increased Integrin ?v?6 Expression.
26667302 2016 Negative feedback regulation of AXL by miR-34a modulates apoptosis in lung cancer cells.
26617947 2015 Downregulated protein expression of transcriptional activator ELK-1 in atrial myocardium of chronic AF patients.
26612202 2016 Functional characterization of a human POU1F1 mutation associated with isolated growth hormone deficiency: a novel etiology for IGHD.
26342199 2015 ELK1 is up-regulated by androgen in bladder cancer cells and promotes tumor progression.
26010542 2015 MZF-1/Elk-1 Complex Binds to Protein Kinase C? Promoter and Is Involved in Hepatocellular Carcinoma.
25537503 2015 Afatinib induces apoptosis in NSCLC without EGFR mutation through Elk-1-mediated suppression of CIP2A.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25066273 2014 Transcription factor Elk-1 participates in the interleukin-1?-dependent regulation of expression of immediate early response gene 3 (IER3).
More...