Property Summary

NCBI Gene PubMed Count 40
Grant Count 1
Funding $1,375
PubMed Score 45.92
PubTator Score 452.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Synonym

Accession P19397 B2R905 Q5U0D6
Symbols MOX44
TSPAN25

Gene

 Grant Application (1)

Gene RIF (12)

PMID Text
25275127 Human CD53 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
25275127 Human CD53 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
25275127 Human CD53 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
25275127 Human CD53 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
23313165 CD53 is associated with population asthma risk via the functional promoter polymorphism -1560 C>T.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20407468 SNP rs6679497 in gene CD53 showed significant association with TNFalpha levels (P=0.001); no association of this SNP was observed with osteoarthritis
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17210617 The paradox is that lymphocytes from RA patients are believed to resist apoptosis, and we suggest that the elevated expression of CD53, which results from the increased oxidative stress, may protect against apoptosis.
More...

AA Sequence

MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLG      1 - 70
CMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQS     71 - 140
FLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQI    141 - 210
DKTSQTIGL                                                                 211 - 219
//

Text Mined References (41)

PMID Year Title
23313165 2013 CD53, a suppressor of inflammatory cytokine production, is associated with population asthma risk via the functional promoter polymorphism -1560 C>T.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21993531 2012 Genome-wide association study does not reveal major genetic determinants for anti-cytomegalovirus antibody response.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20407468 2010 A genome-wide linkage scan reveals CD53 as an important regulator of innate TNF-alpha levels.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17210617 2007 Analysis of the thiol status of peripheral blood leukocytes in rheumatoid arthritis patients.
More...