Property Summary

NCBI Gene PubMed Count 40
PubMed Score 45.70
PubTator Score 452.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma -1.290 3.4e-02
adult high grade glioma 1.300 1.0e-02
astrocytoma 2.300 6.7e-03
Astrocytoma, Pilocytic 1.700 1.6e-08
chronic kidney disease 1.300 1.8e-02
cutaneous lupus erythematosus 2.900 4.4e-05
dermatomyositis 1.100 2.1e-02
diabetes mellitus -1.500 4.9e-02
glioblastoma 1.200 9.3e-04
group 3 medulloblastoma -1.200 8.5e-03
head and neck cancer -1.100 2.6e-02
inflammatory breast cancer 1.100 4.0e-02
interstitial cystitis 2.000 1.1e-03
intraductal papillary-mucinous carcinoma... -1.900 4.9e-03
intraductal papillary-mucinous neoplasm ... -1.600 2.5e-02
invasive ductal carcinoma 1.335 3.5e-03
lung adenocarcinoma -1.300 3.1e-05
lung cancer -1.700 2.4e-02
lung carcinoma -3.300 8.1e-35
Multiple myeloma 1.878 3.1e-04
non-small cell lung cancer -1.225 1.3e-09
osteosarcoma -1.920 5.9e-03
ovarian cancer -2.300 2.2e-06
periodontitis 1.200 2.6e-31
primary Sjogren syndrome 2.800 2.3e-04
psoriasis 1.100 6.3e-07
subependymal giant cell astrocytoma 1.783 2.2e-02
ulcerative colitis 2.800 4.3e-06

Gene RIF (9)

AA Sequence

MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLG      1 - 70
CMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQS     71 - 140
FLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQI    141 - 210
DKTSQTIGL                                                                 211 - 219
//

Text Mined References (41)

PMID Year Title