Property Summary

NCBI Gene PubMed Count 40
PubMed Score 45.92
PubTator Score 452.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung carcinoma 2844 8.10695468691503E-35
periodontitis 269 2.56050731392226E-31
non-small cell lung cancer 2798 1.28273765024738E-9
pilocytic astrocytoma 3086 1.13631891048435E-8
psoriasis 6685 6.34609597854991E-7
ovarian cancer 8492 2.15287421397663E-6
ulcerative colitis 2087 4.30826082379547E-6
glioblastoma 5572 2.73101340586676E-5
lung adenocarcinoma 2714 3.13282186893131E-5
cutaneous lupus erythematosus 1056 4.37480098266349E-5
lung cancer 4473 5.12244262821182E-5
primary Sjogren syndrome 789 2.26755813143322E-4
Multiple myeloma 1328 3.12580643888678E-4
pediatric high grade glioma 2712 0.00166360305687014
invasive ductal carcinoma 2950 0.00351272716151126
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0048607018895894
interstitial cystitis 2299 0.00572041582134798
osteosarcoma 7933 0.00587945039303933
astrocytoma 1493 0.00668737868829291
group 3 medulloblastoma 2254 0.00847324985770053
chronic kidney disease 90 0.0183344955233661
dermatomyositis 967 0.0208194969833982
subependymal giant cell astrocytoma 2287 0.0219675929636466
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.025254331363217
head and neck cancer 270 0.0258991849615002
adrenocortical carcinoma 1427 0.0335267451905432
inflammatory breast cancer 404 0.0400774095393723
diabetes mellitus 1663 0.0486604042336794

Expression

  Differential Expression (28)

Synonym

Accession P19397 B2R905 Q5U0D6
Symbols MOX44
TSPAN25

Gene

  Ortholog (9)

Gene RIF (9)

PMID Text
25275127 Human CD53 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
23313165 CD53 is associated with population asthma risk via the functional promoter polymorphism -1560 C>T.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20407468 SNP rs6679497 in gene CD53 showed significant association with TNFalpha levels (P=0.001); no association of this SNP was observed with osteoarthritis
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17210617 The paradox is that lymphocytes from RA patients are believed to resist apoptosis, and we suggest that the elevated expression of CD53, which results from the increased oxidative stress, may protect against apoptosis.
16506060 Analysis of lymphocyte subsets showed that the total number of CD3+, CD4+, CD8+ and CD56+ lymphocytes increased after the intensive protocol before falling below pre-exercise values at 1 h post-exercise.
12606948 Ligation of CD53 triggers a survival response and reduces the number of cells that enter apoptosis. The CD53 antigen interactions might contribute to cell survival in poorly vascularized regions of the tumor mass.

AA Sequence

MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLG      1 - 70
CMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQS     71 - 140
FLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQI    141 - 210
DKTSQTIGL                                                                 211 - 219
//

Text Mined References (41)

PMID Year Title
23313165 2013 CD53, a suppressor of inflammatory cytokine production, is associated with population asthma risk via the functional promoter polymorphism -1560 C>T.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21993531 2012 Genome-wide association study does not reveal major genetic determinants for anti-cytomegalovirus antibody response.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20407468 2010 A genome-wide linkage scan reveals CD53 as an important regulator of innate TNF-alpha levels.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17210617 2007 Analysis of the thiol status of peripheral blood leukocytes in rheumatoid arthritis patients.
More...