Property Summary

NCBI Gene PubMed Count 96
PubMed Score 33.94
PubTator Score 24.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis -1.100 2.8e-02
diabetes mellitus -1.300 1.2e-03
ductal carcinoma in situ -1.100 5.3e-04
osteosarcoma 1.331 6.9e-04
ovarian cancer -1.200 7.6e-07
psoriasis 1.400 8.2e-03
Rheumatoid arthritis -1.100 4.9e-03

Gene RIF (86)

AA Sequence

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTD      1 - 70
QMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINIT     71 - 140
EHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ    141 - 210
//

Text Mined References (102)

PMID Year Title