Property Summary

NCBI Gene PubMed Count 94
PubMed Score 33.13
PubTator Score 24.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.02057615801076E-4
ductal carcinoma in situ 1745 5.32148423056486E-4
osteosarcoma 7933 6.93318076021814E-4
diabetes mellitus 1663 0.00117181728451975
Rheumatoid Arthritis 1171 0.00489546963036624
psoriasis 6685 0.00822853077695262
dermatomyositis 967 0.0277563550759567

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.005
psoriasis 1.400 0.008
osteosarcoma 1.331 0.001
diabetes mellitus -1.300 0.001
ductal carcinoma in situ -1.100 0.001
ovarian cancer 1.600 0.000
dermatomyositis -1.100 0.028

Synonym

Accession P19388 B2R6L4 D6W5Y1 O43380 Q6PIH5 Q9BT06 RNA polymerases I, II, and III subunit ABC1
Symbols RPB5
XAP4
RPABC1
hRPB25
hsRPB5

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD  

  Ortholog (14)

Gene RIF (86)

PMID Text
25874495 POLR2E rs3787016 C/T and HULC rs7763881 were associated with a significantly decreased risk for ESCC 0.005). ANRIL rs2151280 T/C SNP was not associated with risk of ESCC.
24359561 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24330569 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23827503 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23274668 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23087374 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23028129 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22567366 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22422068 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
More...

AA Sequence

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTD      1 - 70
QMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINIT     71 - 140
EHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ    141 - 210
//

Text Mined References (99)

PMID Year Title
25874495 2015 Long noncoding RNAs POLR2E rs3787016 C/T and HULC rs7763881 A/C polymorphisms are associated with decreased risk of esophageal cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22252557 2012 ELL facilitates RNA polymerase II pause site entry and release.
22102239 2011 Crystallization and preliminary X-ray analysis of the RPB5 subunit of human RNA polymerase II.
21310960 2011 RPB5-mediating protein is required for the proliferation of hepatocellular carcinoma cells.
21269460 2011 Initial characterization of the human central proteome.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...