Property Summary

NCBI Gene PubMed Count 88
PubMed Score 26.08
PubTator Score 11.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.3e-04
Disease Target Count Z-score Confidence
Chikungunya 16 3.234 1.6
Xeroderma pigmentosum group B 20 3.152 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 1.3e-04

Gene RIF (86)

AA Sequence

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGL      1 - 70
IPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPN     71 - 140
DYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSE    141 - 210
LDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN         211 - 275
//

Text Mined References (92)

PMID Year Title