Property Summary

NCBI Gene PubMed Count 88
Grant Count 3
Funding $36,748.01
PubMed Score 25.99
PubTator Score 11.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Chikungunya 12 3.388 1.7
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.000

Synonym

Accession P19387 O15161 RNA polymerase II subunit 3
Symbols RPB3
RPB31
hRPB33
hsRPB3

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD  

Gene RIF (90)

PMID Text
26455390 FUS low-complexicity phase separates to recruit RNA polymerase II C-terminal domain in vitro.
25211001 These findings suggest that N-terminus of Rpb3 selectively inhibits Rpb3-high-expression hepatocellular carcinoma cells proliferation. N-terminus of Rpb3 may be useful in treating patients diagnosed with Rpb3-high-expression hepatocellular carcinoma.
24359561 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24330569 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23827503 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23274668 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23274668 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
More...

AA Sequence

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGL      1 - 70
IPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPN     71 - 140
DYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSE    141 - 210
LDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN         211 - 275
//

Text Mined References (92)

PMID Year Title
26455390 2015 Residue-by-Residue View of In Vitro FUS Granules that Bind the C-Terminal Domain of RNA Polymerase II.
25211001 2014 Rpb3 promotes hepatocellular carcinoma through its N-terminus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21217813 2010 The eEF1? subunit contacts RNA polymerase II and binds vimentin promoter region.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16455777 2006 Ribonucleic acid polymerase II binding subunit 3 (Rpb3), a potential nuclear target of insulin-like growth factor binding protein-3.
More...