Property Summary

NCBI Gene PubMed Count 79
Grant Count 86
R01 Count 44
Funding $8,009,209.32
PubMed Score 357.51
PubTator Score 233.32

Knowledge Summary

Patent (23,440)

Expression

Synonym

Accession P19367 E9PCK0 O43443 O43444 O75574 Q5VTC3 Q96HC8 Q9NNZ4 Q9NNZ5
Symbols HK
HKD
HKI
HXK1
HMSNR
HK1-ta
HK1-tb
HK1-tc
hexokinase

Gene

HK1

PDB

1CZA   1DGK   1HKB   1HKC   1QHA   4F9O   4FOE   4FOI   4FPA   4FPB  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
504762 confirmatory 17 / 0 / 84 Dose Response confirmation of activators of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay
540302 confirmatory 1 / 0 / 89 SAR analysis of small molecule inhibitors of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay
588356 confirmatory 0 / 0 / 44 SAR analysis of small molecule inhibitors of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay - Set 2

Gene RIF (46)

PMID Text
27012210 4-hydroxytamoxifen resistance in breast cancer cells is suppressed by curcumin, which targets the SLUG/Hexokinase 2 pathway
26855992 HK1 and HK2 expression alterations were detected, that could be explained by common deregulation mechanisms of these genes in colorectal tumors. The HK3 expression level was significantly increased in 60% of samples.
26464675 Our results suggest that overexpression of PKM2 and HK1, especially the latter, significantly associates with lymphatic metastasis, advanced clinical staging and unfavorable prognosis in gastric cancer.
26427411 Data indicate a missense mutation in hexokinase 1 (HK1) c.2539G > A, p.Glu847Lys, tracking with disease in all affected family members.
25904018 HK1 expression is highly enriched in neurons compared to astrocytes in the cerebral cortex.
25766729 The transport of glucose across the cell membrane by glucose transporters (GLUTs) and intracellular phosphorylation by hexokinases (HKs) are the initial steps of the glycolytic pathway.
25602755 HK-1 plays a non-metabolic role in HIV-1 infected macrophages by binding to mitochondria thereby maintaining mitochondrial integrity.
25602755 HIV-1 modulates subcellular localization of HK1 favoring increased association of HK1 with mitochondria, and HIV-1 protein Vpr induces accumulation of HK1 from the cytoplasm to the mitochondria
25602755 HIV-1 modulates subcellular localization of HK1 favoring increased association of HK1 with mitochondria, and HIV-1 protein Vpr induces accumulation of HK1 from the cytoplasm to the mitochondria
25501281 The present study was designed to evaluate the involvement of hexokinase and CPT-1 in the cell growth and proliferation of human prostate cancer cell lines, PC3, and LNCaP-FGC-10.
More...

AA Sequence

MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRS      1 - 70
IPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEK     71 - 140
RKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDT    141 - 210
VGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRE    211 - 280
IDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLH    281 - 350
NAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH    351 - 420
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKR    421 - 490
MRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY    491 - 560
AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVG    561 - 630
HDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQ    631 - 700
GQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRG    701 - 770
QISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA    771 - 840
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVR    841 - 910
LRTEASS                                                                   911 - 917
//

Text Mined References (81)

PMID Year Title
27012210 2016 Curcumin suppresses 4-hydroxytamoxifen resistance in breast cancer cells by targeting SLUG/Hexokinase 2 pathway.
26855992 [Evaluation of Gene Expression of Hexokinases in Colorectal Cancer with the Use of Bioinformatics Methods].
26464675 2015 Overexpression of metabolic markers HK1 and PKM2 contributes to lymphatic metastasis and adverse prognosis in Chinese gastric cancer.
26427411 2016 Identification of a Novel Gene on 10q22.1 Causing Autosomal Dominant Retinitis Pigmentosa (adRP).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25904018 2015 Direct neuronal glucose uptake heralds activity-dependent increases in cerebral metabolism.
25766729 2016 High 18F-FDG uptake in PMAH correlated with normal expression of Glut1, HK1, HK2, and HK3.
25602755 2015 Role of hexokinase-1 in the survival of HIV-1-infected macrophages.
25501281 2015 Targeting prostate cancer cell metabolism: impact of hexokinase and CPT-1 enzymes.
25316723 2014 A missense mutation in HK1 leads to autosomal dominant retinitis pigmentosa.
More...