Property Summary

NCBI Gene PubMed Count 213
Grant Count 349
R01 Count 92
Funding $184,321,333.41
PubMed Score 644.46
PubTator Score 1016.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P19338 Q53SK1 Q8NB06 Q9UCF0 Q9UDG1
Symbols C23

Gene

NCL

PDB

2FC8   2FC9   2KRR  

Gene RIF (160)

PMID Text
26540346 Data show that nucleolin (NCL) antagonist N6L inhibits cell growth with different sensitivity depending to NCL localization.
26399567 Nucleolin stabilizes oncostatin-M mRNA by binding to a GC-rich element in its 3'UTR.
26354862 Identification of NCL as a prominent host factor capable of binding with high affinity to the G4 structures present in the LTR promoter of HIV-1.
26283155 These results suggested a clear link between nucleolin expression (including cell membrane nucleolin) and the stem cell-like phenotype in breast cancer, namely in the triple negative molecular subtype.
26238070 HAUSP-nucleolin interaction is regulated by p53-Mdm2 complex in response to DNA damage.
26231209 C1q exists as the C1 complex (C1qC1r2C1s2), and C1q binding to ligands activates the C1r/C1s proteases. Incubation of nucleoli with C1 caused degradation of the nucleolar proteins nucleolin and nucleophosmin 1. T
26183533 study dissects nucleolin-mediated activation of surface AC133 and its cognate gene CD133, via specific interaction of nucleolin with the tissue-dependent CD133 promoter P1
25965334 Data suggest that NCL (nucleolin) is re-localized during lytic KSHV (Kaposi sarcoma-associated herpesvirus) infection and protects IL6 (interleukin-6) mRNA from SOX (KSHV cytoplasmic mRNA-specific endonuclease) degradation in cytoplasm.
25938538 NCL overexpression is involved in liver carcinogenesis.
25921135 Inhibition of C23 expression was shown to increase the radiosensitivity of NSCLC cells, as implied by the relevance to the notably decreased DNA-PKcs phosphorylation activity at the S2056 and T2609 clusters.
More...

AA Sequence

MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTK      1 - 70
KVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNA     71 - 140
KKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEA    141 - 210
METTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKR    211 - 280
KKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFG    281 - 350
YVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR    351 - 420
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVL    421 - 490
SNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGP    491 - 560
RGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAM    561 - 630
EDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDH    631 - 700
KPQGKKTKFE                                                                701 - 710
//

Text Mined References (232)

PMID Year Title
26540346 2015 Nucleolin antagonist triggers autophagic cell death in human glioblastoma primary cells and decreased in vivo tumor growth in orthotopic brain tumor model.
26399567 2016 Stabilization of Oncostatin-M mRNA by Binding of Nucleolin to a GC-Rich Element in Its 3'UTR.
26354862 2015 Nucleolin stabilizes G-quadruplex structures folded by the LTR promoter and silences HIV-1 viral transcription.
26283155 2015 Nucleolin overexpression in breast cancer cell sub-populations with different stem-like phenotype enables targeted intracellular delivery of synergistic drug combination.
26238070 2015 HAUSP-nucleolin interaction is regulated by p53-Mdm2 complex in response to DNA damage response.
26231209 2015 C1q protein binds to the apoptotic nucleolus and causes C1 protease degradation of nucleolar proteins.
26183533 2015 Control of AC133/CD133 and impact on human hematopoietic progenitor cells through nucleolin.
25965334 2015 A ribonucleoprotein complex protects the interleukin-6 mRNA from degradation by distinct herpesviral endonucleases.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25938538 2015 Hepatoma-derived growth factor/nucleolin axis as a novel oncogenic pathway in liver carcinogenesis.
More...