Property Summary

NCBI Gene PubMed Count 464
Grant Count 789
R01 Count 460
Funding $80,046,512.33
PubMed Score 3299.04
PubTator Score 2196.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (65)

Disease Z-score Confidence
Atherosclerosis 275 6.842 3.4
diabetes mellitus 1,663 4.93 2.5
Coronary artery disease 240 4.877 2.4
Hypertension 287 4.732 2.4
Asthma 349 4.565 2.3
Hypersensitivity reaction type II diseas... 235  4.461 2.2
Kidney disease 396 4.451 2.2
Cancer 2,346 4.407 2.2
Rheumatoid Arthritis 1,160 4.255 2.1
Vasculitis 64 4.181 2.1
Multiple Sclerosis 498 4.175 2.1
Cerebrovascular disease 231 4.067 2.0
Inflammatory bowel disease 142 3.823 1.9
Eosinophilia 65 3.747 1.9
Heart disease 279 3.709 1.9
Leukostasis 5 3.672 1.8
Skin disease 65 3.62 1.8
Diabetic Retinopathy 53 3.589 1.8
Obesity 616 3.481 1.7
Hyperglycemia 120 3.473 1.7
Metabolic syndrome X 155 3.443 1.7
Sickle cell anemia 35 3.438 1.7
Lipid metabolism disorder 102 3.316 1.7
Malaria 140 3.282 1.6
Allergic rhinitis 91 3.24 1.6
Peripheral vascular disease 90 3.225 1.6
Lung disease 132 3.166 1.6
Collagen disease 25 3.139 1.6
Encephalitis 54 3.003 1.5
Anemia, Sickle Cell 10
Breast cancer 3,094
Cardiovascular Diseases 50
Cholestasis 93
Diaphragmatic Hernia 40
Duchenne muscular dystrophy 602
Hypercholesterolemia 27
Hypertensive disease 193
Liver carcinoma 217
Myocardial Ischemia 169
Uremia 19
Urticaria 53
acute quadriplegic myopathy 1,157
astrocytoma 1,493
autosomal dominant Emery-Dreifuss muscul... 499 
cutaneous lupus erythematosus 1,056
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
head and neck cancer and chronic obstruc... 237 
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
juvenile dermatomyositis 1,189
malignant mesothelioma 3,162
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
sarcoidosis 358
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

Synonym

Accession P19320 A8K6R7 B4DKS4 E9PDD1 Q6NUP8 V-CAM 1
Symbols CD106
INCAM-100

Gene

PDB

1IJ9   1VCA   1VSC  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
848 other 160 / 0 / 92751 Primary HTS assay during TNFalpha stimulated VCAM1 expression to assess cytotoxicity.
1034 other 0 / 0 / 227 Confirmatory Screen for chemical potentiatiors of TNF alpha stimulated VCAM1 expression

Gene RIF (435)

PMID Text
27044487 Human placental, chorionic villi-derived mesenchymal stem cells expressing VCAM-1 promote angiogenesis in a mouse ischemia model.
26919714 sVCAM-1 concentrations were significantly higher in the bronchoalveolar lavage fluid of patients with acute respiratory distress syndrome compared to healthy controls, and tended to be higher in moderate/severe ARDS compared to mild ARDS.
26872904 BD patients have a lower expression of ICAM-1, VCAM-1, and E-selectin in their tumor tissues. BD-HDL facilitates the adhesion of tumor cells to vascular endothelium by upregulating the expression of ICAM-1 and VCAM-1, thereby promoting the initial progression of breast cancer metastasis
26847082 These metastatic tumors revealed no detectable expression of CK8/18, E-cadherin, VCAM-1, and ICAM-1
26841644 Heterogeneity was found in the endothelial cells: their shape, the expression of adhesion molecules(ICAM-1, VCAM-1, and PECAM ), and the adhesion of lymphocytes and monocytes to them changed during the progression of the atherosclerotic process.
26824050 Clopidogrel diminishes TNFalpha-stimulated VCAM-1 expression at least in part via HO-1 induction and CaMKKbeta/AMPK/Nrf2 pathway in endothelial cells.
26746423 Soluble VCAM1 levels correlated with clinical response in systemic lupus erythematosus patients.
26679764 This study showed that sVCAM-1 levels were decreased in early and late stages of schizophrenia.
26625754 ICAM-1, VCAM-1 and CD34 are useful biomarkers in evaluation of vascular and inflammatory lesions such as gingival pyogenic granuloma and the results indicate the role of these biomarkers in pathogenesis of oral pyogenic granuloma.
26608360 Results show that VCAM1 expression is regulated by TSPO to activate endothelial cells.
More...

AA Sequence

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGK      1 - 70
VTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVA     71 - 140
DVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTV    141 - 210
RQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIA    211 - 280
MRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQ    281 - 350
IDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS    351 - 420
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID    421 - 490
DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSE    491 - 560
NATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPE    561 - 630
TWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELL    631 - 700
VLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV                                   701 - 739
//

Text Mined References (466)

PMID Year Title
27044487 2016 VCAM-1+ placenta chorionic villi-derived mesenchymal stem cells display potent pro-angiogenic activity.
26919714 2016 Soluble Vascular Cell Adhesion Molecule-1 (sVCAM-1) Is Elevated in Bronchoalveolar Lavage Fluid of Patients with Acute Respiratory Distress Syndrome.
26872904 2016 High-density lipoprotein of patients with breast cancer complicated with type 2 diabetes mellitus promotes cancer cells adhesion to vascular endothelium via ICAM-1 and VCAM-1 upregulation.
26847082 2016 Establishment and characterization of a metastasis model of human gastric cancer in nude mice.
26841644 [Adhesion molecules and mononuclear cell subpopulations in the coronary and pulmonary arteries of patients with coronary heart disease].
26824050 2016 Clopidogrel Protects Endothelium by Hindering TNF?-Induced VCAM-1 Expression through CaMKK?/AMPK/Nrf2 Pathway.
26746423 2016 Improved monitoring of clinical response in Systemic Lupus Erythematosus by longitudinal trend in soluble vascular cell adhesion molecule-1.
26679764 2016 Role of sICAM-1 and sVCAM-1 as biomarkers in early and late stages of schizophrenia.
26625754 2015 Immunohistochemical Evaluation of Angiogenesis Related Markers in Pyogenic Granuloma of Gingiva.
26608360 2015 The 18-kDa Translocator Protein Inhibits Vascular Cell Adhesion Molecule-1 Expression via Inhibition of Mitochondrial Reactive Oxygen Species.
More...