Property Summary

NCBI Gene PubMed Count 464
PubMed Score 3299.04
PubTator Score 2196.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.11347424137063E-10
malignant mesothelioma 3163 4.295078253394E-10
Duchenne muscular dystrophy 602 6.10376841167968E-8
posterior fossa group A ependymoma 1511 1.2115241730679E-6
pediatric high grade glioma 2712 1.1410356184254E-5
primary Sjogren syndrome 789 1.28046906045095E-5
glioblastoma 5572 3.59985412162763E-5
ovarian cancer 8492 5.53531930066077E-5
primitive neuroectodermal tumor 3031 6.57586191564942E-5
pituitary cancer 1972 2.77547760281027E-4
cutaneous lupus erythematosus 1056 5.76631318922373E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.81087752024901E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00103794153648068
acute quadriplegic myopathy 1157 0.00104663995955408
osteosarcoma 7933 0.0017274276301923
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00212857908907818
subependymal giant cell astrocytoma 2287 0.00534777201280983
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0127986970779198
astrocytoma 1493 0.013307018290206
esophageal adenocarcinoma 737 0.0176010007179145
gastric carcinoma 832 0.0181506847577788
head and neck cancer and chronic obstructive pulmonary disease 237 0.020197007561294
sarcoidosis 368 0.0210365897669953
sonic hedgehog group medulloblastoma 1482 0.0319018113489595
Breast cancer 3099 0.0446662334279459

Expression

Synonym

Accession P19320 A8K6R7 B4DKS4 E9PDD1 Q6NUP8 V-CAM 1
Symbols CD106
INCAM-100

Gene

PDB

1IJ9   1VCA   1VSC  

  Ortholog (10)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
848 other 160 / 0 / 92751 Primary HTS assay during TNFalpha stimulated VCAM1 expression to assess cytotoxicity.
1034 other 0 / 0 / 227 Confirmatory Screen for chemical potentiatiors of TNF alpha stimulated VCAM1 expression

Gene RIF (429)

PMID Text
27044487 Human placental, chorionic villi-derived mesenchymal stem cells expressing VCAM-1 promote angiogenesis in a mouse ischemia model.
26919714 sVCAM-1 concentrations were significantly higher in the bronchoalveolar lavage fluid of patients with acute respiratory distress syndrome compared to healthy controls, and tended to be higher in moderate/severe ARDS compared to mild ARDS.
26872904 BD patients have a lower expression of ICAM-1, VCAM-1, and E-selectin in their tumor tissues. BD-HDL facilitates the adhesion of tumor cells to vascular endothelium by upregulating the expression of ICAM-1 and VCAM-1, thereby promoting the initial progression of breast cancer metastasis
26847082 These metastatic tumors revealed no detectable expression of CK8/18, E-cadherin, VCAM-1, and ICAM-1
26841644 Heterogeneity was found in the endothelial cells: their shape, the expression of adhesion molecules(ICAM-1, VCAM-1, and PECAM ), and the adhesion of lymphocytes and monocytes to them changed during the progression of the atherosclerotic process.
26824050 Clopidogrel diminishes TNFalpha-stimulated VCAM-1 expression at least in part via HO-1 induction and CaMKKbeta/AMPK/Nrf2 pathway in endothelial cells.
26746423 Soluble VCAM1 levels correlated with clinical response in systemic lupus erythematosus patients.
26679764 This study showed that sVCAM-1 levels were decreased in early and late stages of schizophrenia.
26625754 ICAM-1, VCAM-1 and CD34 are useful biomarkers in evaluation of vascular and inflammatory lesions such as gingival pyogenic granuloma and the results indicate the role of these biomarkers in pathogenesis of oral pyogenic granuloma.
26608360 Results show that VCAM1 expression is regulated by TSPO to activate endothelial cells.
More...

AA Sequence

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGK      1 - 70
VTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVA     71 - 140
DVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTV    141 - 210
RQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIA    211 - 280
MRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQ    281 - 350
IDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS    351 - 420
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID    421 - 490
DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSE    491 - 560
NATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPE    561 - 630
TWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELL    631 - 700
VLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV                                   701 - 739
//

Text Mined References (466)

PMID Year Title
27044487 2016 VCAM-1+ placenta chorionic villi-derived mesenchymal stem cells display potent pro-angiogenic activity.
26919714 2016 Soluble Vascular Cell Adhesion Molecule-1 (sVCAM-1) Is Elevated in Bronchoalveolar Lavage Fluid of Patients with Acute Respiratory Distress Syndrome.
26872904 2016 High-density lipoprotein of patients with breast cancer complicated with type 2 diabetes mellitus promotes cancer cells adhesion to vascular endothelium via ICAM-1 and VCAM-1 upregulation.
26847082 2016 Establishment and characterization of a metastasis model of human gastric cancer in nude mice.
26841644 [Adhesion molecules and mononuclear cell subpopulations in the coronary and pulmonary arteries of patients with coronary heart disease].
26824050 2016 Clopidogrel Protects Endothelium by Hindering TNF?-Induced VCAM-1 Expression through CaMKK?/AMPK/Nrf2 Pathway.
26746423 2016 Improved monitoring of clinical response in Systemic Lupus Erythematosus by longitudinal trend in soluble vascular cell adhesion molecule-1.
26679764 2016 Role of sICAM-1 and sVCAM-1 as biomarkers in early and late stages of schizophrenia.
26625754 2015 Immunohistochemical Evaluation of Angiogenesis Related Markers in Pyogenic Granuloma of Gingiva.
26608360 2015 The 18-kDa Translocator Protein Inhibits Vascular Cell Adhesion Molecule-1 Expression via Inhibition of Mitochondrial Reactive Oxygen Species.
More...