Property Summary

NCBI Gene PubMed Count 68
Grant Count 125
R01 Count 35
Funding $12,307,443.7
PubMed Score 414.14
PubTator Score 331.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19256 A8K7G5 Q5U053 Q6IB65 Q96KI9 Ag3
Symbols ag3
LFA3
LFA-3

Gene

PDB

1CCZ   1CI5   1QA9  

 GO Function (1)

Gene RIF (45)

PMID Text
26194173 Frequent inactivating mutations of CD58 in classical Hodgkin lymphoma cell lines, but their rare occurrence in primary Hodgkin and Reed/Sternberg cells.
26137540 Cytometry analysis evidenced a specific expression profile on reticulocytes of SCA infants, with notably an increased expression of the adhesion molecules Lu/BCAM, ICAM-4 and LFA-3, both in percentage of positive cells and in surface density.
26041540 CD58/CD2 is the primary costimulatory pathway in human CD28-CD8+ T cells.
25984915 the fundamental mechanism of glycosylation of human CD2 is to promote CD2-CD58 binding by conformational adjustment of CD2
25903733 This study demonstrated that the Polymorphism, Single Nucleotide of CD58 is associated with multiple sclerosis in man in Russia.
25884075 The positive correlation is established between content of polymorphic nuclear monocytes and level of expression of molecules of LFA-1, ICAM-1, LFA-3, and PECAM-1.
25795118 Linkage disequilibrium show evidence that mir-548ac rs1414273 variant is strongly associated with Multiple sclerosis (MS)-associated haplotype and confirms the single nucleotide polymorphisms within the first intron of CD58 been related too. [review]
25197941 SNPs in CD58 are associated with increased risk of candidemia.
24727892 Results indicate that CD58 is a novel cell-surface marker that functionally regulates self-renewal of Colorectal tumor-initiating cells.
24655566 Genetic variations in CD58 were associated with the susceptibility of neuromyelitis optica in a Korean population.
More...

AA Sequence

MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSE      1 - 70
FRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEV     71 - 140
QCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSG    141 - 210
HSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN                                  211 - 250
//

Text Mined References (70)

PMID Year Title
26194173 2015 Alterations of the CD58 gene in classical Hodgkin lymphoma.
26137540 2015 Erythroid Adhesion Molecules in Sickle Cell Anaemia Infants: Insights Into Early Pathophysiology.
26041540 2015 CD58/CD2 Is the Primary Costimulatory Pathway in Human CD28-CD8+ T Cells.
25984915 2015 Glycosylation Modulates Human CD2-CD58 Adhesion via Conformational Adjustment.
25903733 2015 GWAS-identified multiple sclerosis risk loci involved in immune response: validation in Russians.
25884075 2014 [The level of expression of molecules of adhesion on monocytes depending on morphological differentiation of nuclei].
25795118 Susceptibility variants in the CD58 gene locus point to a role of microRNA-548ac in the pathogenesis of multiple sclerosis.
25197941 2014 Immunochip SNP array identifies novel genetic variants conferring susceptibility to candidaemia.
24727892 2015 CD58, a novel surface marker, promotes self-renewal of tumor-initiating cells in colorectal cancer.
24655566 2014 CD58 polymorphisms associated with the risk of neuromyelitis optica in a Korean population.
More...