Property Summary

NCBI Gene PubMed Count 70
PubMed Score 418.94
PubTator Score 331.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

 GO Function (1)

Gene RIF (47)

AA Sequence

MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSE      1 - 70
FRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEV     71 - 140
QCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSG    141 - 210
HSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN                                  211 - 250
//

Text Mined References (72)

PMID Year Title