Property Summary

NCBI Gene PubMed Count 33
PubMed Score 40.29
PubTator Score 15.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy -1.280 7.0e-05
group 3 medulloblastoma 1.300 3.3e-02
medulloblastoma, large-cell 1.900 9.2e-03
permanent atrial fibrillation -1.600 2.6e-03

 GO Component (2)

Gene RIF (20)

AA Sequence

MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLSALQDLCRELH      1 - 70
AKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRA     71 - 140
NLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDAAKSPTSQ                           141 - 187
//

Text Mined References (35)

PMID Year Title