Property Summary

NCBI Gene PubMed Count 30
Grant Count 19
R01 Count 9
Funding $1,636,751.98
PubMed Score 36.72
PubTator Score 15.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
permanent atrial fibrillation -1.600 0.003
medulloblastoma, large-cell 1.900 0.009
acute quadriplegic myopathy -1.280 0.000
group 3 medulloblastoma 1.300 0.033

Gene RIF (17)

PMID Text
25996354 Data suggest that mutation A162H in switch region of troponin I induces transitory curved conformation and promotes contraction of troponin I bound to regulatory domain of troponin C; this is countered by residue E164 to ensure proper relaxation.
25791106 TNNI3K is a cardiac-specific gene, encoding a cardiac troponin I-interacting MAP kinase. In mice, Tnni3k is shown to play an important role in the regulation of cardiac differentiation and cardiac contractility
22374183 Elevations of troponin I and N-terminal pro-B-type natriuretic peptide (NT-proBNP) are common in patients with atrial fibrillation and independently related to increased risks of stroke and mortality.
22323298 sTnI as a sensitive marker of skeletal muscle injury.
20817590 Evaluated the prevalence of TNN13 gene mutations in sudden death caused by cardiomyopathy (CM); in dilated CM cases, a new missense mutation Pro16Thr was detected. A single nucleotide polymorphism at -8 position of intron 3 was identified.
19811558 Elevated post-operative troponin 1 levels predict long-term mortality in older patients undergoing emergency orthpedic surgery.
17099250 a localized N-terminal region of TnI comprised of amino acids 33-80, which interacts with C-terminal regions of cTnC and cTnT, is of particular significance in transducing signaling of thin filament activation by strong cross-bridges
17051347 A revised method of troponin exchange in pemeabilized cardiac trabeculae using vanadate: functional consequences of a HCM-causing mutation in troponin I.
16916777 The plasma levels of CRP and troponin I were also significantly higher in this group of nine patients, and correlated with urinary protein excretion.
16358990 Increased serum levels of troponin I is associated with calcinosis and coronary Artery Stenosis
More...

AA Sequence

MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLSALQDLCRELH      1 - 70
AKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRA     71 - 140
NLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDAAKSPTSQ                           141 - 187
//

Text Mined References (32)

PMID Year Title
25996354 2015 Structure and Dynamics of the Acidosis-Resistant A162H Mutant of the Switch Region of Troponin I Bound to the Regulatory Domain of Troponin C.
25791106 2015 Whole exome sequencing identifies the TNNI3K gene as a cause of familial conduction system disease and congenital junctional ectopic tachycardia.
25416956 2014 A proteome-scale map of the human interactome network.
22374183 2012 Cardiac biomarkers are associated with an increased risk of stroke and death in patients with atrial fibrillation: a Randomized Evaluation of Long-term Anticoagulation Therapy (RE-LY) substudy.
22323298 2012 Serum skeletal troponin I following inspiratory threshold loading in healthy young and middle-aged men.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20817590 2010 Analysis of the sarcomere protein gene mutation on cardiomyopathy - Mutations in the cardiac troponin I gene.
19811558 2010 Impact of troponin 1 on long-term mortality after emergency orthopaedic surgery in older patients.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17099250 2007 Identification of a region of troponin I important in signaling cross-bridge-dependent activation of cardiac myofilaments.
More...