Property Summary

NCBI Gene PubMed Count 204
Grant Count 357
R01 Count 169
Funding $38,727,068.1
PubMed Score 579.43
PubTator Score 460.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19235 B2RCG4 Q15443 Q2M205 EPO-R
Symbols EPO-R

Gene

PDB

1CN4   1EER   1EBA   1EBP   1ERN   2JIX   2MV6   4Y5V   4Y5X   4Y5Y  

Gene RIF (130)

PMID Text
26846855 These results identify EPOR as the secondbona fidehydroxylation-dependent substrate of VHL that potentially influences oxygen homeostasis and contributes to the complex genotype-phenotype correlation in VHL disease.
26412593 We report for a first time that functional EpoR is expressed in human rhabdomyosarcoma cell lines as well as by primary tumors from RMS patients.
26159733 erythrocyte lineage enforces exclusivity through upregulation of EKLF and its lineage-specific cytokine receptor (EpoR) while inhibiting both FLI-1 and the receptor TpoR (also known as MPL) for the opposing megakaryocyte lineage
26097591 In multivariate survival analysis, age, Epo and EpoR were independent prognostic factors related to overall survival in hepatocellular carcinoma.
26010769 A new point mutation in EPOR induces a short deletion in congenital erythrocytosis.
25887776 basic mechanisms for hypoxia-inducible factor induction of EPO expression, and within erythroid progenitors EPOR engagement of canonical Janus kinase 2/signal transducer and activator of transcription 5 (JAK2/STAT5)
25874769 Data show that erythropoietin receptor antagonist EMP9 suppressed hemoglobin synthesis in xenografts of HeLa cells.
25544764 Data suggest that erythropoietin receptor (EPOR) could be a target to overcome therapeutic resistance toward ionizing radiation or temozolomide.
25418301 transmembrane domain and the juxtamembrane region of the erythropoietin receptor in micelles
24533580 3 novel EPOR mutations in primary familial and congenital polycythemia--Del1377-1411, a C1370A and G1445--were chimerized with EGFR to study signalling and metabolism of the chimeric receptors.
More...

AA Sequence

MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASA      1 - 70
GVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHIN     71 - 140
EVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNL    141 - 210
RGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQ    211 - 280
KIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTD    281 - 350
DEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS    351 - 420
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYE    421 - 490
NSLIPAAEPLPPSYVACS                                                        491 - 508
//

Text Mined References (205)

PMID Year Title
26846855 2016 Oxygen-dependent Regulation of Erythropoietin Receptor Turnover and Signaling.
26412593 2015 Human rhabdomyosarcoma cells express functional erythropoietin receptor: Potential therapeutic implications.
26159733 2015 Robust hematopoietic progenitor cell commitment in the presence of a conflicting cue.
26097591 2015 Erythropoietin and erythropoietin receptor in hepatocellular carcinoma: correlation with vasculogenic mimicry and poor prognosis.
26010769 2016 A new point mutation in EPOR inducing a short deletion in congenital erythrocytosis.
25887776 2015 Emerging EPO and EPO receptor regulators and signal transducers.
25874769 2015 Erythropoietin Receptor Antagonist Suppressed Ectopic Hemoglobin Synthesis in Xenografts of HeLa Cells to Promote Their Destruction.
25544764 2015 Silencing erythropoietin receptor on glioma cells reinforces efficacy of temozolomide and X-rays through senescence and mitotic catastrophe.
25418301 2014 Structural insight into the transmembrane domain and the juxtamembrane region of the erythropoietin receptor in micelles.
24533580 2014 Polycythaemia-inducing mutations in the erythropoietin receptor (EPOR): mechanism and function as elucidated by epidermal growth factor receptor-EPOR chimeras.
More...