Property Summary

Ligand Count 7
NCBI Gene PubMed Count 216
PubMed Score 631.63
PubTator Score 460.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Primary polycythemia 8 0.0 4.0

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.500 2.2e-03
atypical teratoid / rhabdoid tumor 1.600 1.6e-03
dermatomyositis -1.200 1.9e-04
glioblastoma 1.600 1.4e-03
intraductal papillary-mucinous adenoma (... -1.300 5.9e-03
intraductal papillary-mucinous carcinoma... -1.100 2.5e-02
intraductal papillary-mucinous neoplasm ... -1.400 2.2e-02
lung cancer -1.600 1.4e-02
medulloblastoma -1.100 6.4e-04
medulloblastoma, large-cell -1.100 8.1e-05
osteosarcoma -3.653 1.9e-08
ovarian cancer 2.400 1.9e-13
pancreatic ductal adenocarcinoma liver m... -1.209 3.1e-02
psoriasis -2.600 4.3e-05
Rheumatoid arthritis -1.400 1.5e-02

 GWAS Trait (1)

Gene RIF (138)

AA Sequence

MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASA      1 - 70
GVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHIN     71 - 140
EVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNL    141 - 210
RGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQ    211 - 280
KIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTD    281 - 350
DEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS    351 - 420
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYE    421 - 490
NSLIPAAEPLPPSYVACS                                                        491 - 508
//

Text Mined References (217)

PMID Year Title