Property Summary

NCBI Gene PubMed Count 115
Grant Count 51
R01 Count 36
Funding $5,186,258.99
PubMed Score 586.50
PubTator Score 200.09

Knowledge Summary

Patent

No data available

Gene RIF (86)

PMID Text
26684499 Oxidative stress and histone modifications may promote transcriptional activation of Ugt1a6 and Ugt1a7 genes.
26039129 Identified coding variants on UGT1A1 and UGT1A6 genes in association with serum bilirubin level and hyperbilirubinemia risk in elderly subjects.
24255116 Results suggest that CYP3A4 changes the catalytic function of the UGT1A subfamily in a UGT isoform-specific manner.
24036429 Evaluating the association of UGT1A6 2 Ser7Ala polymorphism with drug response, there was no significant difference in the genotypic distribution between responders and non-responders.
23441093 Validation of variants in SLC28A3 and UGT1A6 as genetic markers predictive of anthracycline-induced cardiotoxicity in children.
23099353 Lower adjusted plasma VPA concentrations were also observed in patients with UGT1A6 double heterozygosities than those with single heterozygosity.
22912755 UGT1A6 polymorphisms may be used to identify people with increased risk of developing lung cancer
22901212 Polymorphism in UDP-glucuronosyltransferase 1A6 is associated with colorectal cancer.
22450351 Dual polymorphisms of UDP glucuronosyl-transferases 1A6 and 1A1 in a patient with Gilbert's syndrome who had persistent hyperserotoninemia that responded to octreotide are reported.
22228101 the protective T allele of rs17863783 was found to be associated with increased mRNA expression of UGT1A6.1; study suggests that rs17863783 may protect from bladder cancer by increasing the removal of carcinogens from bladder epithelium by the UGT1A6.1 protein
More...

AA Sequence

MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVVPEVNLLLKES      1 - 70
KYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFK     71 - 140
ESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVA    141 - 210
NFLVNLLEPYLFYCLFSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCK    211 - 280
KRKDLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTIL    281 - 350
VKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE    351 - 420
DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDV    421 - 490
IGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                491 - 532
//

Text Mined References (119)

PMID Year Title
26684499 2016 Effects of Phenobarbital on Expression of UDP-Glucuronosyltransferase 1a6 and 1a7 in Rat Brain.
26039129 2015 Exome-Wide Association Study Identifies New Low-Frequency and Rare UGT1A1 Coding Variants and UGT1A6 Coding Variants Influencing Serum Bilirubin in Elderly Subjects: A Strobe Compliant Article.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255116 2014 Alteration of the function of the UDP-glucuronosyltransferase 1A subfamily by cytochrome P450 3A4: different susceptibility for UGT isoforms and UGT1A1/7 variants.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24036429 2013 Three most common nonsynonymous UGT1A6*2 polymorphisms (Thr181Ala, Arg184Ser and Ser7Ala) and therapeutic response to deferiprone in ?-thalassemia major patients.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
More...