Property Summary

NCBI Gene PubMed Count 276
Grant Count 158
R01 Count 104
Funding $16,143,756.48
PubMed Score 766.55
PubTator Score 448.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.010 0.000
lung cancer 1.100 0.001

Synonym

Accession P19174 B7ZLY7 B9EGH4 E1P5W4 Q2V575
Symbols PLC1
NCKAP3
PLC-II
PLC148
PLCgamma1

Gene

PDB

1HSQ   2HSP   4EY0   4FBN  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
720700 screening 3123 / 0 / 367153 Fluorescence-based biochemical high throughput primary assay to identify inhibitors of phospholipase C isozymes (PLC-gamma1).
720733 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of phospholipase C isozymes (PLC-gamma1).
743258 screening 102 / 0 / 3162 Counterscreen for inhibitors of phospholipase C isozymes (PLC-B3): Fluorescence-based biochemical high throughput assay to identify inhibitors of phospholipase C isozymes (PLC-gamma1)
743329 confirmatory 13 / 0 / 144 Counterscreen for inhibitors of phospholipase C isozymes (PLC-B3): Fluorescence-based biochemical high throughput dose response assay to identify inhibitors of phospholipase C isozymes (PLC-gamma1)

Gene RIF (129)

PMID Text
26735859 Report PLCG1 genetic alterations in angiosarcomas.
26481038 In a transgenic mouse model, PLCgamma1 is the dominant signaling effector by which activation of TrkB promotes epilepsy.
26464646 expression of PLC-gamma1 and PIKE positively correlated with the tumor differentiation of oral squamous cell carcinoma.
25964059 hsa-miR-665 and hsa-miR-95 were downregulated in GSRCC but upregulated in intestinal gastric adenocarcinoma, and the relatively differential expression of the miRNAs negatively controlling their target genes, GLI2 and PLCG1
25910029 PLLG1 protein mutations are uncommon in cutaneous T-cell lymphomas.
25491205 PLCgamma1 is part of the molecular mechanism.
25456276 Data from structural, genetic, and mechanistic studies on the role of PLCG1 in cell biology suggest that dysfunctional forms of PLCG1 are linked to immune disorders and cancer. [REVIEW]
25304611 Recurrent presence of the PLCG1 S345F mutation is associated with nodal peripheral T-cell lymphomas.
25252913 these findings indicate that the PLCgamma1-R707Q mutation causes constitutive activation of PLCgamma1 and may represent an alternative way of activation of KDR/PLCg1 signaling besides KDR activation in angiosarcomas
25162020 This SOCS7 knockdown-attributed effect could be due to a precise anti-PLCg-1 role.
More...

AA Sequence

MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIE      1 - 70
GAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWL     71 - 140
MEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITY    141 - 210
GQFAQLYRSLMYSAQKTMDLPFLEASTLRAGERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSF    211 - 280
LRDPLREIEEPYFFLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSL    281 - 350
EAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA    351 - 420
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMMYSENDISNSI    421 - 490
KNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRD    491 - 560
GRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFD    561 - 630
SLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPN    631 - 700
SYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPD    701 - 770
YGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLW    771 - 840
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMASVAHWSLD    841 - 910
VAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDM    911 - 980
SSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMN    981 - 1050
QALFMTGRHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAE   1051 - 1120
YDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAV   1121 - 1190
PLKNNYSEDLELASLLIKIDIFPAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDF   1191 - 1260
RISQEHLADHFDSRERRAPRRTRVNGDNRL                                           1261 - 1290
//

Text Mined References (301)

PMID Year Title
26735859 2016 Recurrent CIC Gene Abnormalities in Angiosarcomas: A Molecular Study of 120 Cases With Concurrent Investigation of PLCG1, KDR, MYC, and FLT4 Gene Alterations.
26481038 2015 A Peptide Uncoupling BDNF Receptor TrkB from Phospholipase C?1 Prevents Epilepsy Induced by Status Epilepticus.
26464646 2015 Reduced expression of E-cadherin and p120-catenin and elevated expression of PLC-?1 and PIKE are associated with aggressiveness of oral squamous cell carcinoma.
25964059 2015 Screening of differential microRNA expression in gastric signet ring cell carcinoma and gastric adenocarcinoma and target gene prediction.
25910029 2015 PLCG1 Gene Mutations Are Uncommon in Cutaneous T-Cell Lymphomas.
25491205 2015 PLC?1 participates in protein transport and diacylglycerol production triggered by cargo arrival at the Golgi.
25456276 2014 Dysfunction of phospholipase C? in immune disorders and cancer.
25304611 2015 Recurrent presence of the PLCG1 S345F mutation in nodal peripheral T-cell lymphomas.
25252913 2014 A recurrent activating PLCG1 mutation in cardiac angiosarcomas increases apoptosis resistance and invasiveness of endothelial cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...