Property Summary

NCBI Gene PubMed Count 55
PubMed Score 472.21
PubTator Score 469.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 2.6e-02
facioscapulohumeral dystrophy 3.100 4.2e-06
intraductal papillary-mucinous neoplasm ... -1.200 2.5e-03
invasive ductal carcinoma 1.074 2.7e-02
lung adenocarcinoma -1.400 1.0e-05
lung cancer -1.600 6.1e-03
non-small cell lung cancer -1.463 6.0e-19
osteosarcoma -3.728 1.6e-08
pituitary cancer 1.300 3.3e-03
psoriasis -1.100 7.5e-03

Gene RIF (37)

AA Sequence

MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVV      1 - 70
HWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSS     71 - 140
QGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESCLNARLVAYASDQAHSSVEKAGLISLVKMKF    141 - 210
LPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTA    211 - 280
FLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQ    281 - 350
IPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT    351 - 420
ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCTSQPSPRVGNL    421 - 490
ISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGLHLETLLDPVDDCFSEEAPDA    491 - 560
TKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPTEASVKNGGSSRVRIFSRFPEDMMMLKKSAF    561 - 630
KKLIKFYSVPSFPECSSQCGLQLPCCPLQAMV                                          631 - 662
//

Text Mined References (58)

PMID Year Title