Property Summary

NCBI Gene PubMed Count 52
PubMed Score 457.39
PubTator Score 469.00

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Gilles de la Tourette syndrome 47
Disease Target Count P-value
non-small cell lung cancer 2798 5.99561731192136E-19
osteosarcoma 7933 1.57523796590199E-8
facioscapulohumeral dystrophy 286 4.22304335070028E-6
lung adenocarcinoma 2714 1.01742928983281E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00248499910100833
pituitary cancer 1972 0.00333438251005189
lung cancer 4473 0.00613844552382466
psoriasis 6685 0.00746259443935372
cutaneous lupus erythematosus 1056 0.0259900735858147
invasive ductal carcinoma 2950 0.027178289632254
Disease Target Count
Tourette Syndrome 3


  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 0.026
psoriasis -1.100 0.007
osteosarcoma -3.728 0.000
non-small cell lung cancer -1.463 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.002
lung cancer -1.600 0.006
lung adenocarcinoma -1.400 0.000
invasive ductal carcinoma 1.074 0.027
pituitary cancer 1.300 0.003
facioscapulohumeral dystrophy 3.100 0.000


Accession P19113 A1L4G0 B7ZM01 HDC



PANTHER Protein Class (2)



  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (34)

25846768 HDC rs17740607 polymorphism is at least a partial loss-of-function variant and acts as a protective factor against chronic heart failure
24835231 The findings indicate that polymorphisms of HDC gene were significantly associated with breast cancer in Chinese Han population and may be novel diagnostic or therapeutic targets for breast cancer.
24415870 HDC production in the stomach is associated with bile acid exposure and its related transcriptional regulation network of FXR, SHP, and CDX1.
23825391 Investigated variation across the HDC (histidine decarboxylase) gene for association with Tourette Syndrome.
23572231 Data indicate that histidine decarboxylase (HDC) is expressed by neutrophils.
22767596 Structural study reveals that Ser-354 determines substrate specificity on human histidine decarboxylase.
22684068 crystal of histidine decarboxylase belonged to space group C2, with unit-cell parameters a = 215.16, b = 112.72, c = 171.39 A, beta = 110.3 degrees
22095709 Variants in the HDC gene may play little or no role in Tourette Syndrome susceptibility in Chinese Han population.
21915437 It was shown that for serum and urine, HDC levels achieved sensitivities and specificities compatible to or even greater than those of established biomarkers for the diagnosis of intestinal mucosal injury in patients with acute intestinal obstruction.
21873469 The novel concept that an autocrine loop, consisting of enhanced histamine synthesis by histidine decarboxylase, sustains cholangiocarcinoma growth is proposed.

AA Sequence

KKLIKFYSVPSFPECSSQCGLQLPCCPLQAMV                                          631 - 662

Text Mined References (55)

PMID Year Title
25846768 2015 Relation of polymorphism of the histidine decarboxylase gene to chronic heart failure in Han Chinese.
25416956 2014 A proteome-scale map of the human interactome network.
24835231 2014 Associations of polymorphisms in histidine decarboxylase, histamine N-methyltransferase and histamine receptor H3 genes with breast cancer.
24415870 2014 Bile acid increases expression of the histamine-producing enzyme, histidine decarboxylase, in gastric cells.
23825391 2013 Support of the histaminergic hypothesis in Tourette syndrome: association of the histamine decarboxylase gene in a large sample of families.
23572231 2013 Histamine production by human neutrophils.
22767596 2012 Structural study reveals that Ser-354 determines substrate specificity on human histidine decarboxylase.
22684068 2012 Purification, crystallization and preliminary X-ray analysis of human histidine decarboxylase.
22095709 2012 Mutation screening of the HDC gene in Chinese Han patients with Tourette syndrome.
21915437 2011 Histidine decarboxylase is identified as a potential biomarker of intestinal mucosal injury in patients with acute intestinal obstruction.