Property Summary

NCBI Gene PubMed Count 13
PubMed Score 32.13
PubTator Score 5.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19105 Q53X45
Symbols MLCB
MRCL3
MRLC3
MYL2B
MLC-2B
HEL-S-24

Gene

Gene RIF (1)

PMID Text
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain

AA Sequence

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD      1 - 70
AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE     71 - 140
LYREAPIDKKGNFNYIEFTRILKHGAKDKDD                                           141 - 171
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22909821 2012 AATF/Che-1 acts as a phosphorylation-dependent molecular modulator to repress p53-driven apoptosis.
21457715 2011 Chelerythrine perturbs lamellar actomyosin filaments by selective inhibition of myotonic dystrophy kinase-related Cdc42-binding kinase.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
17719568 2007 Subtractive hybridisation screen identifies genes regulated by glucose deprivation in human neuroblastoma cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
More...