Property Summary

NCBI Gene PubMed Count 13
PubMed Score 32.88
PubTator Score 5.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD      1 - 70
AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE     71 - 140
LYREAPIDKKGNFNYIEFTRILKHGAKDKDD                                           141 - 171
//

Text Mined References (15)

PMID Year Title