Property Summary

NCBI Gene PubMed Count 13
PubMed Score 32.88
PubTator Score 5.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession P19105 Q53X45
Symbols MLCB
MRCL3
MRLC3
MYL2B
MLC-2B
HEL-S-24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD      1 - 70
AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE     71 - 140
LYREAPIDKKGNFNYIEFTRILKHGAKDKDD                                           141 - 171
//

Text Mined References (15)

PMID Year Title