Property Summary

NCBI Gene PubMed Count 13
PubMed Score 32.13
PubTator Score 5.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession P19105 Q53X45
Symbols MLCB
MRCL3
MRLC3
MYL2B
MLC-2B
HEL-S-24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain

AA Sequence

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD      1 - 70
AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE     71 - 140
LYREAPIDKKGNFNYIEFTRILKHGAKDKDD                                           141 - 171
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22909821 2012 AATF/Che-1 acts as a phosphorylation-dependent molecular modulator to repress p53-driven apoptosis.
21457715 2011 Chelerythrine perturbs lamellar actomyosin filaments by selective inhibition of myotonic dystrophy kinase-related Cdc42-binding kinase.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
17719568 2007 Subtractive hybridisation screen identifies genes regulated by glucose deprivation in human neuroblastoma cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11942626 2001 Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2216787 1990 Human nonsarcomeric 20,000 Da myosin regulatory light chain cDNA.