Property Summary

Ligand Count 711
NCBI Gene PubMed Count 323
PubMed Score 695.87
PubTator Score 619.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-03
aldosterone-producing adenoma 5.767 2.9e-06
Amyotrophic lateral sclerosis -1.087 1.3e-05
astrocytoma -1.100 2.6e-02
atypical teratoid / rhabdoid tumor -1.100 5.3e-05
glioblastoma -1.300 7.0e-07
group 4 medulloblastoma -1.100 8.2e-04
juvenile dermatomyositis -1.238 4.9e-11
medulloblastoma, large-cell -1.200 1.1e-04
ovarian cancer -1.400 1.8e-07

Gene RIF (354)

AA Sequence

MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQ      1 - 70
TFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFN     71 - 140
RLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLG    141 - 210
LVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAF    211 - 280
NRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAAS    281 - 350
ISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP    351 - 420
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILR    421 - 490
PGTSPLLTFRAIN                                                             491 - 503
//

Text Mined References (323)

PMID Year Title