Property Summary

NCBI Gene PubMed Count 308
Grant Count 96
R01 Count 60
Funding $6,222,861.49
PubMed Score 654.59
PubTator Score 619.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 0.026
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.200 0.000
juvenile dermatomyositis -1.238 0.000
Amyotrophic Lateral Sclerosis -1.087 0.000
pediatric high grade glioma -1.100 0.000
group 4 medulloblastoma -1.100 0.001
aldosterone-producing adenoma 5.767 0.000
ovarian cancer -1.400 0.000

Synonym

Accession P19099 B0ZBE4 Q16726
Symbols CPN2
ALDOS
CYP11B
CYP11BL
CYPXIB2
P450C18
P-450C18
P450aldo

Gene

PDB

4DVQ   4FDH   4ZGX  

Gene RIF (339)

PMID Text
26765578 Adrenal tumors in patients with primary aldosteronism can demonstrate clear heterogeneity in cytochrome P450 family 11 subfamily B member 2 (CYP11B2) expression and somatic mutations in driver genes for aldosterone production
26686590 Gene polymorphism of CYP11B2 (-344C>T) may be associated with developing preeclampsia during pregnancy.
26556555 Polymorphisms of three genes (ACE, AGT and CYP11B2) in the renin-angiotensin-aldosterone system are not associated with blood pressure salt sensitivity. (Meta-analysis)
26305278 Strong synergistic effect between ACE and CY11B2 gene polymorphisms in the molecular pathogenesis of Essential Hypertension in Kazakhs in Xinjiang was identified.
26222001 The study explores the relation between ACE D/I and CYP11B2 C-344T polymorphisms and parameters of arterial stiffness in the context of renal sodium handling.
26200036 univariate and multivariable analyses revealed no association between -344C/T of CYP11B2 and plasma glucose in patients with no diabetes, Homeostasis Model Assessment as an Index of Insulin Resistance, or left ventricular mass indexed to height.
26066897 Chimeric CYP11B2/CYP11B1 causing 11beta-hydroxylase deficiency in Chinese patients with congenital adrenal hyperplasia
25966076 suggested that the -344T>C polymorphism in Studies suggest that the cytochrome P450 11B2 (CYP11B2) gene might be associated with susceptibility to CAD in Caucasians and Asians.
25917967 Our results suggest that the down-regulation of ANP gene expression at mRNA and protein levels and up-regulated CYP11B2 protein expression levels may be correlated with the essential hypertension
25768006 Obesity risk increased with GRK4 A486V and CYP11B2 variants in Korean girls as sodium intake increased.
More...

AA Sequence

MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQ      1 - 70
TFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFN     71 - 140
RLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLG    141 - 210
LVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAF    211 - 280
NRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAAS    281 - 350
ISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP    351 - 420
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILR    421 - 490
PGTSPLLTFRAIN                                                             491 - 503
//

Text Mined References (308)

PMID Year Title
26765578 2016 Molecular Heterogeneity in Aldosterone-Producing Adenomas.
26686590 2016 Analysis of the gene polymorphism of aldosterone synthase (CYP11B2) and atrial natriuretic peptide (ANP) in women with preeclampsia.
26556555 2016 Polymorphisms of three genes (ACE, AGT and CYP11B2) in the renin-angiotensin-aldosterone system are not associated with blood pressure salt sensitivity: A systematic meta-analysis.
26305278 2016 Synergistic effects of gene polymorphisms of the renin-angiotensin-aldosterone system on essential hypertension in Kazakhs in Xinjiang.
26222001 2015 The relation between ACE D/I and CYP11B2 C-344T polymorphisms and parameters of arterial stiffness in the context of renal sodium handling.
26200036 2015 Aldosterone Synthase Promoter Polymorphism and Cardiovascular Phenotypes in a Large, Multiethnic Population-Based Study.
26066897 2015 Chimeric CYP11B2/CYP11B1 causing 11?-hydroxylase deficiency in Chinese patients with congenital adrenal hyperplasia.
25966076 2015 Association between the CYP11B2 gene -344T>C polymorphism and coronary artery disease: a meta-analysis.
25917967 2015 Atrial natriuretic peptide and aldosterone synthase gene in essential hypertension: a case-control study.
25768006 2015 Gender-based differences on the association between salt-sensitive genes and obesity in Korean children aged between 8 and 9 years.
More...