Property Summary

NCBI Gene PubMed Count 31
PubMed Score 33.68
PubTator Score 27.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.200 1.9e-02

 OMIM Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (8)

AA Sequence

MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFK      1 - 70
AIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACF     71 - 140
ERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKK    141 - 210
WIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKK    211 - 280
VHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD    281 - 350
CGLF                                                                      351 - 354
//

Text Mined References (31)

PMID Year Title