Property Summary

NCBI Gene PubMed Count 39
PubMed Score 38.56
PubTator Score 45.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.55384297062782E-19
osteosarcoma 7933 4.37109625317641E-9
atypical teratoid / rhabdoid tumor 4369 1.84177996809818E-7
lung adenocarcinoma 2714 4.64850905529503E-7
pediatric high grade glioma 2712 5.62393521759631E-7
pilocytic astrocytoma 3086 2.66540925852081E-6
glioblastoma 5572 9.79359018145606E-6
lung cancer 4473 7.98948776718296E-5
psoriasis 6685 1.33808509588268E-4
medulloblastoma, large-cell 6234 2.73925725742096E-4
colon cancer 1475 2.93070011833413E-4
breast carcinoma 1614 4.17558839841985E-4
cutaneous lupus erythematosus 1056 0.0274225507483001
astrocytic glioma 2241 0.0330964199691761
subependymal giant cell astrocytoma 2287 0.0432507497322735

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.100 0.033
cutaneous lupus erythematosus -1.100 0.027
psoriasis -2.000 0.000
osteosarcoma -2.796 0.000
glioblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -1.700 0.000
colon cancer -1.300 0.000
lung cancer 1.700 0.000
breast carcinoma -1.500 0.000
pediatric high grade glioma -1.800 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.523 0.043
lung adenocarcinoma -1.900 0.000
lung carcinoma 1.100 0.000

Synonym

Accession P19086 B2R6C1 Q4QRJ6
Symbols

Gene

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (3)

PMID Text
20424519 GNAZ mutations are associated with melanoma.
19946729 cGMP-phosphodiesterase 6 can be activated by another cancer-retina antigen, transducin, through Wnt5a-Frizzled-2 cascade, which leads to a lowering of cGMP and an increase in intracellular calcium mobilization.
15326221 findings suggest that Galphaz signals may attenuate Rho-induced stimulation of SRF-mediated transcription

AA Sequence

MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYK      1 - 70
PLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQAC     71 - 140
FSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERK    141 - 210
KWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIR    211 - 280
RIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK    281 - 350
YIGLC                                                                     351 - 355
//

Text Mined References (40)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20424519 2010 Novel somatic mutations in heterotrimeric G proteins in melanoma.
19946729 2010 cGMP-phosphodiesterase 6, transducin and Wnt5a/Frizzled-2-signaling control cGMP and Ca(2+) homeostasis in melanoma cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16892066 2006 Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15326221 2004 Galphaz inhibits serum response factor-dependent transcription by inhibiting Rho signaling.
More...