Property Summary

NCBI Gene PubMed Count 39
Grant Count 10
R01 Count 9
Funding $3,745,393
PubMed Score 38.56
PubTator Score 45.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.100 0.033
cutaneous lupus erythematosus -1.100 0.027
psoriasis -2.000 0.000
osteosarcoma -2.796 0.000
glioblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -1.700 0.000
colon cancer -1.300 0.000
lung cancer 1.700 0.000
breast carcinoma -1.500 0.000
pediatric high grade glioma -1.800 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.523 0.043
lung adenocarcinoma -1.900 0.000
lung carcinoma 1.100 0.000

Gene RIF (3)

PMID Text
20424519 GNAZ mutations are associated with melanoma.
19946729 cGMP-phosphodiesterase 6 can be activated by another cancer-retina antigen, transducin, through Wnt5a-Frizzled-2 cascade, which leads to a lowering of cGMP and an increase in intracellular calcium mobilization.
15326221 findings suggest that Galphaz signals may attenuate Rho-induced stimulation of SRF-mediated transcription

AA Sequence

MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYK      1 - 70
PLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQAC     71 - 140
FSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERK    141 - 210
KWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIR    211 - 280
RIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK    281 - 350
YIGLC                                                                     351 - 355
//

Text Mined References (40)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20424519 2010 Novel somatic mutations in heterotrimeric G proteins in melanoma.
19946729 2010 cGMP-phosphodiesterase 6, transducin and Wnt5a/Frizzled-2-signaling control cGMP and Ca(2+) homeostasis in melanoma cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16892066 2006 Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15326221 2004 Galphaz inhibits serum response factor-dependent transcription by inhibiting Rho signaling.
More...