Property Summary

NCBI Gene PubMed Count 41
PubMed Score 41.83
PubTator Score 45.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 7.8e-06
astrocytic glioma -1.100 3.3e-02
Astrocytoma, Pilocytic -1.200 4.7e-06
atypical teratoid / rhabdoid tumor -2.400 1.8e-07
breast carcinoma -1.500 4.2e-04
colon cancer -1.300 2.9e-04
cutaneous lupus erythematosus -1.100 2.7e-02
glioblastoma -1.400 4.7e-08
lung adenocarcinoma -1.900 4.6e-07
lung cancer 1.700 8.0e-05
lung carcinoma 1.100 1.6e-19
medulloblastoma, large-cell -1.700 2.7e-04
osteosarcoma -2.796 4.4e-09
psoriasis -2.000 1.3e-04
subependymal giant cell astrocytoma -1.523 4.3e-02

Protein-protein Interaction (8)

Gene RIF (3)

AA Sequence

MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYK      1 - 70
PLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQAC     71 - 140
FSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERK    141 - 210
KWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIR    211 - 280
RIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK    281 - 350
YIGLC                                                                     351 - 355
//

Text Mined References (42)

PMID Year Title