Property Summary

NCBI Gene PubMed Count 60
PubMed Score 51.92
PubTator Score 35.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (24)

Gene RIF (49)

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILG      1 - 70
FLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQE     71 - 140
AIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVI    141 - 210
GISFGLAVIEILGLVFSMVLYCQIGNK                                               211 - 237
//

Text Mined References (62)

PMID Year Title