Property Summary

NCBI Gene PubMed Count 52
PubMed Score 48.84
PubTator Score 35.18

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19075 B2R7T7 Q9BS78 Tspan-8
Symbols CO-029
TM4SF3

Gene

Gene RIF (41)

PMID Text
26649804 This novel nuclear localization of TM4SF3 depends on androgen-induced nuclear localization of androgen receptor (AR) in both androgen-dependent and androgen-independent prostate cancer cell lines
26562525 Our data suggest that TSPAN8-LEL may play an important role in mCRC cell invasion, and that the antibody we have developed could be a useful tool for inhibiting the invasion of TSPAN8-expressing mCRCs.
25680464 Tspn8 was over-expressed in multiple clinical malignant glioma tissues, and its expression level correlated with the grade of tumors.
25261323 Based on nasopharyngeal TSPAN8 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants.
22679508 CO-029 functions as a regulator of both cell-matrix and cell-cell adhesion. During colon cancer progression, CO-029 promotes cancer cell movement by deregulating cell adhesions.
21081927 High TSPAN8 is associated with melanoma invasiveness.
20937409 PMA-induced Tspan8-internalization promotes cell migration, but reduces matrix and cell adhesion.
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILG      1 - 70
FLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQE     71 - 140
AIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVI    141 - 210
GISFGLAVIEILGLVFSMVLYCQIGNK                                               211 - 237
//

Text Mined References (54)

PMID Year Title
26649804 2016 TM4SF3 and AR: A Nuclear Complex that Stabilizes Both Proteins.
26562525 2015 Generation of a human antibody that inhibits TSPAN8-mediated invasion of metastatic colorectal cancer cells.
25680464 2015 Over-expression of tetraspanin 8 in malignant glioma regulates tumor cell progression.
25261323 2015 Nasopharyngeal gene expression, a novel approach to study the course of respiratory syncytial virus infection.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22679508 2012 Tetraspanin CO-029 inhibits colorectal cancer cell movement by deregulating cell-matrix and cell-cell adhesions.
21081927 2011 Gene expression profiles of human melanoma cells with different invasive potential reveal TSPAN8 as a novel mediator of invasion.
20937409 2011 Activation-induced internalization differs for the tetraspanins CD9 and Tspan8: Impact on tumor cell motility.
20927120 2010 Variations in/nearby genes coding for JAZF1, TSPAN8/LGR5 and HHEX-IDE and risk of type 2 diabetes in Han Chinese.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
More...