Property Summary

NCBI Gene PubMed Count 52
PubMed Score 48.84
PubTator Score 35.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 4.57257119344347E-9
non-small cell lung cancer 2798 3.35426603985285E-8
psoriasis 6685 5.94870376164462E-8
malignant mesothelioma 3163 6.72545928646606E-8
adrenocortical adenoma 134 4.40795363353184E-4
Duchenne muscular dystrophy 602 7.55672904865743E-4
limb girdle muscular dystrophy 2B 74 0.00173711303372154
group 3 medulloblastoma 2254 0.00195064741082419
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00263007221828375
lung cancer 4473 0.0027862840673058
dermatomyositis 967 0.00324803840510495
Polycystic Ovary Syndrome 335 0.00325002579258932
Atopic dermatitis 944 0.00330098522792513
primary pancreatic ductal adenocarcinoma 1271 0.00365506812821543
pancreatic cancer 2300 0.00391738748638728
lung adenocarcinoma 2714 0.00631773054152816
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00734760635211891
aldosterone-producing adenoma 664 0.00798025929107852
interstitial cystitis 2299 0.0103849788875661
cutaneous lupus erythematosus 1056 0.0124877672616186
Breast cancer 3099 0.0172652590945925
esophageal adenocarcinoma 737 0.0176010007179145
Barrett's esophagus 185 0.0205520993689133
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.027642293839173
Disease Target Count Z-score Confidence
Creutzfeldt-Jakob disease 19 0.0 1.0
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.303 1.7

Expression

Synonym

Accession P19075 B2R7T7 Q9BS78 Tspan-8
Symbols CO-029
TM4SF3

Gene

  Ortholog (10)

Gene RIF (41)

PMID Text
26649804 This novel nuclear localization of TM4SF3 depends on androgen-induced nuclear localization of androgen receptor (AR) in both androgen-dependent and androgen-independent prostate cancer cell lines
26562525 Our data suggest that TSPAN8-LEL may play an important role in mCRC cell invasion, and that the antibody we have developed could be a useful tool for inhibiting the invasion of TSPAN8-expressing mCRCs.
25680464 Tspn8 was over-expressed in multiple clinical malignant glioma tissues, and its expression level correlated with the grade of tumors.
25261323 Based on nasopharyngeal TSPAN8 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants.
22679508 CO-029 functions as a regulator of both cell-matrix and cell-cell adhesion. During colon cancer progression, CO-029 promotes cancer cell movement by deregulating cell adhesions.
21081927 High TSPAN8 is associated with melanoma invasiveness.
20937409 PMA-induced Tspan8-internalization promotes cell migration, but reduces matrix and cell adhesion.
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILG      1 - 70
FLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQE     71 - 140
AIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVI    141 - 210
GISFGLAVIEILGLVFSMVLYCQIGNK                                               211 - 237
//

Text Mined References (54)

PMID Year Title
26649804 2016 TM4SF3 and AR: A Nuclear Complex that Stabilizes Both Proteins.
26562525 2015 Generation of a human antibody that inhibits TSPAN8-mediated invasion of metastatic colorectal cancer cells.
25680464 2015 Over-expression of tetraspanin 8 in malignant glioma regulates tumor cell progression.
25261323 2015 Nasopharyngeal gene expression, a novel approach to study the course of respiratory syncytial virus infection.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22679508 2012 Tetraspanin CO-029 inhibits colorectal cancer cell movement by deregulating cell-matrix and cell-cell adhesions.
21081927 2011 Gene expression profiles of human melanoma cells with different invasive potential reveal TSPAN8 as a novel mediator of invasion.
20937409 2011 Activation-induced internalization differs for the tetraspanins CD9 and Tspan8: Impact on tumor cell motility.
20927120 2010 Variations in/nearby genes coding for JAZF1, TSPAN8/LGR5 and HHEX-IDE and risk of type 2 diabetes in Han Chinese.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
More...