Property Summary

NCBI Gene PubMed Count 60
PubMed Score 51.92
PubTator Score 35.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (24)

Synonym

Accession P19075 B2R7T7 Q9BS78 Tspan-8
Symbols CO-029
TM4SF3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (49)

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILG      1 - 70
FLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQE     71 - 140
AIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVI    141 - 210
GISFGLAVIEILGLVFSMVLYCQIGNK                                               211 - 237
//

Text Mined References (62)

PMID Year Title