Property Summary

NCBI Gene PubMed Count 272
PubMed Score 1382.94
PubTator Score 909.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
lung cancer 2.700 1.8e-04
acute myeloid leukemia -1.800 2.7e-02
adrenocortical carcinoma -2.644 5.3e-03
atypical teratoid / rhabdoid tumor 1.600 3.5e-03
gastric carcinoma -1.800 5.9e-03
group 4 medulloblastoma 1.100 2.3e-03
interstitial cystitis 1.200 3.8e-05
lung carcinoma 4.600 1.7e-48
malignant mesothelioma -1.300 2.0e-06
osteosarcoma 1.811 8.1e-03
ovarian cancer 1.200 1.6e-02
pediatric high grade glioma 1.200 4.4e-04
pituitary cancer 1.300 6.1e-05
posterior fossa group B ependymoma 1.400 1.5e-08
psoriasis -1.400 8.8e-32

Gene RIF (215)

AA Sequence

MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKFSNCNGKRKVQ      1 - 70
YESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEE     71 - 140
IVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIF    141 - 210
IINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGS    211 - 280
KPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQ    281 - 350
ATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY    351 - 420
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVID    421 - 490
VNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLD    491 - 560
RESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDI    561 - 630
DPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKV    631 - 700
CQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNI    701 - 770
LKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL    771 - 840
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD        841 - 906
//

Text Mined References (277)

PMID Year Title