Property Summary

NCBI Gene PubMed Count 238
PubMed Score 1255.97
PubTator Score 909.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 1.69335677696565E-48
psoriasis 6685 8.80036745136984E-32
posterior fossa group B ependymoma 1530 1.50210352497266E-8
lung cancer 4473 5.25100418300828E-7
malignant mesothelioma 3163 2.02664427741369E-6
interstitial cystitis 2299 3.82819161941721E-5
pituitary cancer 1972 6.14441118124355E-5
pediatric high grade glioma 2712 4.38023362492728E-4
sonic hedgehog group medulloblastoma 1482 0.00111345444533643
atypical teratoid / rhabdoid tumor 4369 0.0034900115091092
adrenocortical carcinoma 1427 0.00528625248700578
gastric carcinoma 832 0.00590280772231615
osteosarcoma 7933 0.00809780698904521
ovarian cancer 8492 0.0157871860295073
acute myeloid leukemia 785 0.0271747964129984
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 5.993 3.0
Cardiomyopathy 110 3.418 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
osteosarcoma 1.811 0.008
sonic hedgehog group medulloblastoma 1.300 0.001
atypical teratoid / rhabdoid tumor 1.600 0.003
adrenocortical carcinoma -2.644 0.005
lung cancer 6.100 0.000
interstitial cystitis 1.200 0.000
pediatric high grade glioma 1.200 0.000
posterior fossa group B ependymoma 1.400 0.000
lung carcinoma 4.600 0.000
gastric carcinoma -1.800 0.006
acute myeloid leukemia -1.800 0.027
ovarian cancer 1.200 0.016
pituitary cancer 1.300 0.000
psoriasis -1.400 0.000

Synonym

Accession P19022 A8MWK3 B0YIY6 Q14923 Q8N173
Symbols CDHN
NCAD
CD325
CDw325

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (187)

PMID Text
26927375 Data show that grape seed proanthocyanidins could inhibit cell proliferation, invasion and migration of A549 cells, which might be related to the down-regulation of epidermal growth factor receptor and N-cadherin and the up-regulation of E-cadherin.
26702618 These data suggest that the number of polyploid giant cancer cells and the EMT-related proteins E-cadherin, N-cadherin, and vimentin may be valuable biomarkers to assess metastasis in patients with breast cancer.
26451610 Targeting N-cadherin may be a promising therapeutic approach, particularly in cisplatin-resistant, therapy refractory and metastatic Germ cell tumor.
26359363 Metformin's anti-cancer therapeutic effect is mediated through different molecular mechanism in wild-type vs. deficient N-cadherin cancer cells.
26260219 Expression data of NCAD shows no association with advanced gastric cancer brain metastasis.
26093892 Of the seven polymorphisms, two reached statistical significance for obsessive-compulsive disorder under additive and codominant models of inheritance
26069251 Foxn3 is a direct transcriptional suppressor of N-cadherin in colorectal metastasis tissues.
26032459 CDH2 was found to be a susceptibility gene for Gilles de la Tourette syndrome in a Danish cohort.
25936636 N-cadherin was widely expressed in CRC cell lines and silencing of N-cadherin suppressed the proliferation and migration of the CRC cell line HT-29 by upregulating E-cadherin, suggesting a potential role of N-cadherin in inducing EMT.
25803827 It was shown that both E- and N-cadherin mRNA and protein are expressed in the human renal proximal tubule.
More...

AA Sequence

MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKFSNCNGKRKVQ      1 - 70
YESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEE     71 - 140
IVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIF    141 - 210
IINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGS    211 - 280
KPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQ    281 - 350
ATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY    351 - 420
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVID    421 - 490
VNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLD    491 - 560
RESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDI    561 - 630
DPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKV    631 - 700
CQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNI    701 - 770
LKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL    771 - 840
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD        841 - 906
//

Text Mined References (243)

PMID Year Title
26927375 2016 [Grape seed proanthocyanidins inhibits the invasion and migration of A549 lung cancer cells].
26702618 2015 The number of polyploid giant cancer cells and epithelial-mesenchymal transition-related proteins are associated with invasion and metastasis in human breast cancer.
26451610 2015 Role of N-cadherin in proliferation, migration, and invasion of germ cell tumours.
26359363 2015 Metformin represses cancer cells via alternate pathways in N-cadherin expressing vs. N-cadherin deficient cells.
26260219 2015 Clinicopathological significance of N-cadherin and VEGF in advanced gastric cancer brain metastasis and the effects of metformin in preclinical models.
26093892 2016 Polymorphisms within the neuronal cadherin (CDH2) gene are associated with obsessive-compulsive disorder (OCD) in a South African cohort.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26069251 2015 A Systematic Approach to Defining the microRNA Landscape in Metastasis.
26032459 2015 Association study between CDH2 and Gilles de la Tourette syndrome in a Danish cohort.
25936636 2015 N-cadherin, a novel prognostic biomarker, drives malignant progression of colorectal cancer.
More...