Property Summary

NCBI Gene PubMed Count 27
Grant Count 30
R01 Count 27
Funding $2,050,587.48
PubMed Score 90.97
PubTator Score 131.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma -4.400 0.020
osteosarcoma 2.051 0.000
non-small cell lung cancer -1.165 0.006
lung cancer -4.500 0.017
lung adenocarcinoma -1.800 0.000
nasopharyngeal carcinoma -4.100 0.000
lung carcinoma -1.100 0.000
spina bifida -2.448 0.036
ovarian cancer 1.400 0.001
head and neck cancer and chronic obstruc... -1.900 0.019
psoriasis -3.100 0.000

Gene RIF (10)

PMID Text
25603146 The crystal structure of recombinant Srr-1-K4BD(485-642) and its possible mode of interaction with K4 through docking studies, are reported.
23182699 Identification of a mutation of the keratin 4 gene recurrent in a family affected by white sponge nevus.
21498718 Fascin has a potential role as an early detection biomarker and CK4 as a tumor marker in esophageal squamous cell carcinoma.
21371075 The aberrant expression of K4 and K13 and concomitant up-regulation of the other keratins may be one of the causative factors for morphological alterations in the affected epithelium.
19515043 Infection by HPV stimulates the expression of cytokeratin 4
19468302 Data found that Plk1 binds and directly phosphorylates the HsCYK-4 at the midzone and this modification creates a major docking site for the tandem BRCT repeats of the Rho GTP exchange factor Ect2.
19468300 Failure to phosphorylate HsCyk-4 blocks Ect2 recruitment to the central spindle and the subsequent induction of furrowing.
19460752 Knockdown of keratin 4 (KRT4) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18992023 2 new mutations were found in the keratin 4 gene, the heterozygous missense mutation 1829G-->A in exon 2B, and 2324A-->G in non-coding region, which may be related with the development of WSN.
17709412 Deletion of the srr-1 gene in the genome of S. agalactiae revealed that this gene plays a role in bacterial binding to human K4 and that it is involved in adherence to epithelial HEp-2 cells.

AA Sequence

MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQ      1 - 70
GACFGGAGGFGTGGFGAGGFGAGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEI     71 - 140
DPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLR    141 - 210
KQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLN    211 - 280
DEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQ    281 - 350
LQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEA    351 - 420
ALQQAKEELARMLREYQELMSVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGISGGL    421 - 490
GSGSGFGLSSGFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR                              491 - 534
//

Text Mined References (29)

PMID Year Title
25603146 2015 Structure of KRT4 binding domain of Srr-1 from Streptococcus agalactiae reveals a novel ?-sheet complementation.
25416956 2014 A proteome-scale map of the human interactome network.
23182699 2013 Mutation of keratin 4 gene causing white sponge nevus in a Japanese family.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21498718 2011 Fascin and CK4 as biomarkers for esophageal squamous cell carcinoma.
21371075 2011 Down-regulation of keratin 4 and keratin 13 expression in oral squamous cell carcinoma and epithelial dysplasia: a clue for histopathogenesis.
21269460 2011 Initial characterization of the human central proteome.
19515043 2009 Comparative analysis of the expression of cytokeratins (1, 10, 14, 16, 4), involucrin, filaggrin and e-cadherin in plane warts and epidermodysplasia verruciformis plane wart-type lesions.
19468302 2009 Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells.
More...