Property Summary

NCBI Gene PubMed Count 27
PubMed Score 90.97
PubTator Score 131.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 2.4348181749871E-44
lung carcinoma 2844 4.6294472692893E-10
nasopharyngeal carcinoma 1056 6.02839676435782E-9
lung adenocarcinoma 2714 1.54468237102945E-7
osteosarcoma 7933 4.65880949124119E-7
ovarian cancer 8492 0.00124598081742779
non-small cell lung cancer 2798 0.0056746270548191
lung cancer 4473 0.0167135480409128
head and neck cancer and chronic obstructive pulmonary disease 237 0.0185984485006946
esophageal adenocarcinoma 737 0.0195207517873976
spina bifida 1064 0.035817889435841
Disease Target Count Z-score Confidence
Hymenolepiasis 5 3.656 1.8
Cholesteatoma 13 3.651 1.8
Cancer 2346 3.345 1.7

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma -4.400 0.020
osteosarcoma 2.051 0.000
non-small cell lung cancer -1.165 0.006
lung cancer -4.500 0.017
lung adenocarcinoma -1.800 0.000
nasopharyngeal carcinoma -4.100 0.000
lung carcinoma -1.100 0.000
spina bifida -2.448 0.036
ovarian cancer 1.400 0.001
head and neck cancer and chronic obstruc... -1.900 0.019
psoriasis -3.100 0.000

Synonym

Accession P19013 F8VS64 Q6GTR8 Q96LA7 Q9BTL1
Symbols K4
CK4
CK-4
CYK4
WSN1

Gene

  Ortholog (8)

Gene RIF (10)

PMID Text
25603146 The crystal structure of recombinant Srr-1-K4BD(485-642) and its possible mode of interaction with K4 through docking studies, are reported.
23182699 Identification of a mutation of the keratin 4 gene recurrent in a family affected by white sponge nevus.
21498718 Fascin has a potential role as an early detection biomarker and CK4 as a tumor marker in esophageal squamous cell carcinoma.
21371075 The aberrant expression of K4 and K13 and concomitant up-regulation of the other keratins may be one of the causative factors for morphological alterations in the affected epithelium.
19515043 Infection by HPV stimulates the expression of cytokeratin 4
19468302 Data found that Plk1 binds and directly phosphorylates the HsCYK-4 at the midzone and this modification creates a major docking site for the tandem BRCT repeats of the Rho GTP exchange factor Ect2.
19468300 Failure to phosphorylate HsCyk-4 blocks Ect2 recruitment to the central spindle and the subsequent induction of furrowing.
19460752 Knockdown of keratin 4 (KRT4) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18992023 2 new mutations were found in the keratin 4 gene, the heterozygous missense mutation 1829G-->A in exon 2B, and 2324A-->G in non-coding region, which may be related with the development of WSN.
17709412 Deletion of the srr-1 gene in the genome of S. agalactiae revealed that this gene plays a role in bacterial binding to human K4 and that it is involved in adherence to epithelial HEp-2 cells.

AA Sequence

MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQ      1 - 70
GACFGGAGGFGTGGFGAGGFGAGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEI     71 - 140
DPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLR    141 - 210
KQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLN    211 - 280
DEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQ    281 - 350
LQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEA    351 - 420
ALQQAKEELARMLREYQELMSVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGISGGL    421 - 490
GSGSGFGLSSGFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR                              491 - 534
//

Text Mined References (29)

PMID Year Title
25603146 2015 Structure of KRT4 binding domain of Srr-1 from Streptococcus agalactiae reveals a novel ?-sheet complementation.
25416956 2014 A proteome-scale map of the human interactome network.
23182699 2013 Mutation of keratin 4 gene causing white sponge nevus in a Japanese family.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21498718 2011 Fascin and CK4 as biomarkers for esophageal squamous cell carcinoma.
21371075 2011 Down-regulation of keratin 4 and keratin 13 expression in oral squamous cell carcinoma and epithelial dysplasia: a clue for histopathogenesis.
21269460 2011 Initial characterization of the human central proteome.
19515043 2009 Comparative analysis of the expression of cytokeratins (1, 10, 14, 16, 4), involucrin, filaggrin and e-cadherin in plane warts and epidermodysplasia verruciformis plane wart-type lesions.
19468302 2009 Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells.
More...