Property Summary

NCBI Gene PubMed Count 27
PubMed Score 93.87
PubTator Score 131.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma -4.400 2.0e-02
head and neck cancer and chronic obstruc... -1.900 1.9e-02
lung adenocarcinoma -1.100 2.4e-12
lung cancer -4.500 1.7e-02
lung carcinoma -1.100 4.6e-10
nasopharyngeal carcinoma -4.100 6.0e-09
non-small cell lung cancer -1.165 5.7e-03
osteosarcoma 2.051 4.7e-07
ovarian cancer 1.400 1.2e-03
psoriasis -3.100 2.4e-44
spina bifida -2.448 3.6e-02

Synonym

Accession P19013 F8VS64 Q6GTR8 Q96LA7 Q9BTL1
Symbols K4
CK4
CK-4
CYK4
WSN1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQ      1 - 70
GACFGGAGGFGTGGFGAGGFGAGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEI     71 - 140
DPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLR    141 - 210
KQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLN    211 - 280
DEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQ    281 - 350
LQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEA    351 - 420
ALQQAKEELARMLREYQELMSVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGISGGL    421 - 490
GSGSGFGLSSGFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR                              491 - 534
//

Text Mined References (29)

PMID Year Title